MCID: BNM001
MIFTS: 44

Bone Marrow Cancer

Categories: Blood diseases, Bone diseases, Cancer diseases, Immune diseases
Data Licensing
For inquiries, contact:

Aliases & Classifications for Bone Marrow Cancer

MalaCards integrated aliases for Bone Marrow Cancer:

Name: Bone Marrow Cancer 11 14
Malignant Neoplasm of Bone Marrow 11 71
Chronic Myeloproliferative Disorder 71
Myeloproliferative Disorders 43
Malignant Bone Marrow Tumor 11
Myeloproliferative Disease 71
Bone Marrow Neoplasms 71
Bone Marrow Neoplasm 11
Bone-Marrow Cancer 75
Bone Marrow Tumor 11

Classifications:



External Ids:

Disease Ontology 11 DOID:4960
MeSH 43 D009196
SNOMED-CT 68 128925001
ICD10 31 D47.1
UMLS 71 C0027022 C0282609 C1292778 more

Summaries for Bone Marrow Cancer

Disease Ontology: 11 A hematopoietic cancer that derives from the blood-forming stem cells of the bone marrow.

MalaCards based summary: Bone Marrow Cancer, also known as malignant neoplasm of bone marrow, is related to myeloproliferative neoplasm and essential thrombocythemia. An important gene associated with Bone Marrow Cancer is U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1), and among its related pathways/superpathways are miRNAs involved in DNA damage response and miRNAs involvement in the immune response in sepsis. The drugs Thalidomide and Amitriptyline have been mentioned in the context of this disorder. Affiliated tissues include bone marrow, bone and myeloid.

Wikipedia: 75 Multiple myeloma (MM), also known as plasma cell myeloma and simply myeloma, is a cancer of plasma... more...

Related Diseases for Bone Marrow Cancer

Diseases related to Bone Marrow Cancer via text searches within MalaCards or GeneCards Suite gene sharing:

(show top 50) (show all 584)
# Related Disease Score Top Affiliating Genes
1 myeloproliferative neoplasm 33.4 U2AF1 MIR155 LUC7L2 KDM4C JAK2 H2AC18
2 essential thrombocythemia 32.4 U2AF1 LUC7L2 JAK2 H2AC18
3 myelodysplastic/myeloproliferative neoplasm 32.4 U2AF1 LUC7L2 JAK2
4 myelodysplastic syndrome 32.3 U2AF1 MIR9-1 MIR34A MIR221 MIR199A1 MIR17
5 chronic myelomonocytic leukemia 31.7 U2AF1 LUC7L2 KDM4C JAK2 H2AC18
6 leukemia, acute myeloid 31.5 U2AF1 MIR9-1 MIR34A MIR221 MIR21 MIR199A1
7 blood platelet disease 31.3 U2AF1 MIR142 LUC7L2 JAK2 ICOSLG H2AC18
8 atypical chronic myeloid leukemia, bcr-abl1 negative 31.3 U2AF1 LUC7L2 JAK2
9 acute erythroid leukemia 31.2 U2AF1 KDM4C JAK2 H2AC18
10 deficiency anemia 31.2 U2AF1 MIR126 LUC7L2 JAK2 ICOSLG H2AC18
11 chronic neutrophilic leukemia 31.2 U2AF1 LUC7L2 JAK2
12 leukemia, acute lymphoblastic 31.1 U2AF1 MIR9-1 MIR221 MIR21 MIR199A1 MIR181A1
13 lymphoma, hodgkin, classic 31.0 MIR9-1 MIR21 MIR155 MIR140 KDM4C JAK2
14 hematologic cancer 31.0 U2AF1 MIR9-1 MIR34A MIR221 MIR21 MIR199A1
15 neutrophilia, hereditary 31.0 U2AF1 LUC7L2 JAK2
16 leukemia, chronic lymphocytic 30.9 U2AF1 MIR9-1 MIR34A MIR221 MIR21 MIR199A1
17 chronic leukemia 30.9 U2AF1 LUC7L2 KDM4C JAK2 H2AC18
18 portal hypertension 30.9 MIR199A1 JAK2 CCR6
19 thrombocytopenia due to platelet alloimmunization 30.9 U2AF1 ICOSLG CCR6
20 hypertension, essential 30.8 MIR9-1 MIR34A MIR221 MIR21 MIR199A1 MIR181A1
21 acquired von willebrand syndrome 30.8 U2AF1 JAK2
22 vascular disease 30.8 MIR21 MIR199A1 MIR145 MIR126 MIR125A
23 allergic disease 30.7 MIR21 MIR155 ICOSLG H2AC18 CCR6
24 viral infectious disease 30.7 MIR21 MIR199A1 MIR155 ICOSLG H2AC18 CCR6
25 mantle cell lymphoma 30.6 U2AF1 MIR9-1 MIR17 MIR155 KDM4C ICOSLG
26 neuroblastoma 30.5 MIR34A MIR221 MIR21 MIR181A1 MIR17 MIR145
27 peripheral artery disease 30.5 MIR21 MIR199A1 MIR17 MIR126
28 intermediate coronary syndrome 30.5 MIR21 MIR17 MIR145 MIR142 MIR126
29 systemic scleroderma 30.5 MIR21 MIR142 ICOSLG H2AC18 CCR6
30 microvascular complications of diabetes 5 30.5 MIR21 MIR199A1 MIR17 MIR126 H2AC18
31 aplastic anemia 30.5 U2AF1 LUC7L2 H2AC18 CCR6
32 leukemia, chronic myeloid 30.5 U2AF1 MIR9-1 MIR199A1 MIR17 MIR155 MIR142
33 exanthem 30.4 ICOSLG H2AC18 CCR6
34 myelophthisic anemia 30.4 U2AF1 JAK2
35 leukemia, acute monocytic 30.4 U2AF1 MIR155 H2AC18
36 acute promyelocytic leukemia 30.4 U2AF1 MIR9-1 MIR221 MIR181A1 MIR17 MIR126
37 gastrointestinal stromal tumor 30.4 U2AF1 MIR199A1 JAK2 H2AC18
38 parkinson disease, late-onset 30.4 MIR9-1 MIR21 MIR155 MIR142 MIR126 MIR125A
39 myeloma, multiple 30.4 U2AF1 MIR9-1 MIR221 MIR21 MIR199A1 MIR181A1
40 alzheimer disease, familial, 1 30.4 MIR9-1 MIR34A MIR21 MIR199A1 MIR181A1 MIR17
41 sm-ahnmd 30.4 U2AF1 JAK2
42 lipoprotein quantitative trait locus 30.3 MIR34A MIR221 MIR21 MIR199A1 MIR181A1 MIR17
43 cerebrovascular disease 30.3 MIR9-1 MIR221 MIR21 MIR199A1 MIR181A1 MIR17
44 ewing sarcoma 30.3 MIR9-1 MIR199A1 KDM4C H2AC18
45 breast cancer 30.3 MIR9-1 MIR34A MIR221 MIR21 MIR199A1 MIR181A1
46 skin disease 30.3 U2AF1 MIR9-1 MIR34A MIR221 MIR21 MIR199A1
47 arteries, anomalies of 30.3 MIR9-1 MIR34A MIR221 MIR21 MIR199A1 MIR181A1
48 lung cancer 30.3 U2AF1 MIR9-1 MIR34A MIR221 MIR21 MIR199A1
49 diamond-blackfan anemia 11.1
50 juvenile myelomonocytic leukemia 11.1

Graphical network of the top 20 diseases related to Bone Marrow Cancer:



Diseases related to Bone Marrow Cancer

Symptoms & Phenotypes for Bone Marrow Cancer

Drugs & Therapeutics for Bone Marrow Cancer

Drugs for Bone Marrow Cancer (from DrugBank, HMDB, Dgidb, PharmGKB, IUPHAR, NovoSeek, BitterDB):

(show top 50) (show all 433)
# Name Status Phase Clinical Trials Cas Number PubChem Id
1
Thalidomide Approved, Investigational, Withdrawn Phase 3 50-35-1 5426
2
Amitriptyline Approved Phase 3 50-48-6 2160
3
Baclofen Approved Phase 3 1134-47-0 2284
4
Ketamine Approved, Vet_approved Phase 3 6740-88-1, 1867-66-9 3821
5
Pomalidomide Approved Phase 3 19171-19-8 134780
6
Ondansetron Approved, Withdrawn Phase 3 99614-02-5 4595
7
Morphine Approved, Investigational Phase 3 57-27-2 5288826
8
Sirolimus Approved, Investigational Phase 3 53123-88-9 5284616 6436030
9
Reviparin Approved, Investigational Phase 3 9041-08-1
10
Amphotericin B Approved, Investigational Phase 3 1397-89-3 5280965
11
Nystatin Approved, Vet_approved Phase 3 1400-61-9 11953884
12
Deoxycholic acid Approved Phase 3 83-44-3 222528
13
Dextromethorphan Approved Phase 3 125-71-3 5362449 5360696
14
Hydrocortisone succinate Approved Phase 3 2203-97-6 3643
15
Hydrocortisone acetate Approved, Vet_approved Phase 3 50-03-3
16
Hydrocortisone Approved, Vet_approved Phase 3 50-23-7 3640 5754
17
Luspatercept Approved, Investigational Phase 3 1373715-00-4
18
Aprepitant Approved, Investigational Phase 3 170729-80-3 6918365 135413536
19
Crofelemer Approved Phase 3 33507-63-0, 148465-45-6 36511 44359816
20
Fosaprepitant Approved Phase 3 172673-20-0 219090 135413538
21
Sodium citrate Approved, Investigational Phase 3 68-04-2 23431961
22
Acetylsalicylic acid Approved, Vet_approved Phase 3 50-78-2 2244
23
Hydroxyzine Approved Phase 3 68-88-2 3658
24
Histamine Approved, Investigational Phase 3 51-45-6 774
25
Apixaban Approved Phase 3 503612-47-3 10182969
26
Rivaroxaban Approved Phase 3 366789-02-8 9875401
27
Etoposide Approved Phase 3 33419-42-0 36462
28
Triamcinolone Approved, Vet_approved Phase 3 124-94-7 31307
29
Daunorubicin Approved Phase 3 20830-81-3 30323
30
Picropodophyllin Approved, Investigational Phase 3 518-28-5, 477-47-4 10607 72435
31
Mitoxantrone Approved, Investigational Phase 3 70476-82-3, 65271-80-9 4212
32
Asparaginase Escherichia coli Approved, Investigational Phase 3 9015-68-3
33
Mercaptopurine Approved Phase 3 50-44-2 667490
34
Tioguanine Approved Phase 3 154-42-7 2723601
35
Cyclophosphamide Approved, Investigational Phase 3 50-18-0, 6055-19-2 2907
36
Levoleucovorin Approved, Experimental, Investigational Phase 3 68538-85-2, 58-05-9, 73951-54-9 149436 6006
37
Methotrexate Approved Phase 3 1959-05-2, 59-05-2 4112 126941
38
Tacrolimus Approved, Investigational Phase 3 104987-11-3 6473866 445643
39
Estradiol Approved, Investigational, Vet_approved Phase 3 50-28-2 5757
40
Ethinylestradiol Approved Phase 3 57-63-6 5991
41
Polyestradiol phosphate Approved Phase 3 28014-46-2
42
Norgestimate Approved, Investigational Phase 3 35189-28-7 6540478
43
Moxifloxacin Approved, Investigational Phase 3 186826-86-8, 354812-41-2, 151096-09-2 152946
44
Isotretinoin Approved, Investigational, Nutraceutical Phase 3 302-79-4, 4759-48-2 5538 444795 5282379
45
St. John's Wort Approved, Investigational, Nutraceutical Phase 3 84082-80-4
46
Citric acid Approved, Nutraceutical, Vet_approved Phase 3 77-92-9 311
47
Aspartic acid Approved, Nutraceutical Phase 3 56-84-8 5960
48
Asparagine Approved, Investigational, Nutraceutical Phase 3 70-47-3 6267
49
Folic acid Approved, Nutraceutical, Vet_approved Phase 3 59-30-3 6037
50 Anti-Bacterial Agents Phase 3

Interventional clinical trials:

(show top 50) (show all 554)
# Name Status NCT ID Phase Drugs
1 Busulfan Dose Escalation Study Based on AUC in the Setting of Busulfan/Fludarabine Conditioning Prior to Allogeneic Hematopoietic Cell Transplantation (HCT) Completed NCT00361140 Phase 4 Busulfan;Fludarabine
2 Laser Therapy Prevents Mucositis Oral in Patients Undergoing to Chemotherapy for Bone Marrow Transplantation? A Randomized Clinical Trial. Unknown status NCT02020928 Phase 3
3 Intravenous Low-Dose Decitabine Versus Supportive Care in Elderly Patients With Primary Myelodysplastic Syndrome (MDS) (>10% Blasts or High-Risk Cytogenetics), Secondary MDS or Chronic Myelomonocytic Leukemia (CMML) Who Are Not Eligible for Intensive Therapy: An EORTC-German MDS Study Group Randomized Phase III Study Unknown status NCT00043134 Phase 3 decitabine
4 Prospective Study of the Diagnosis and Treatment of Myelodysplastic Syndromes (MDS) in Childhood Unknown status NCT00047268 Phase 3 cytarabine;mercaptopurine
5 Evaluation of Plasmatic Levels of Busulfan in Patients Undergoing Hematopoietic Stem Cell Transplantation Unknown status NCT01800643 Phase 2, Phase 3
6 Phase III Randomized Trial of an Opioid Titration Order Sheet Compared to Standard of Care in Patients With Cancer Related Pain. Completed NCT00666211 Phase 3
7 Preparatory Aid to Improve Decision Making About Cancer Clinical Trials (PRE-ACT) Completed NCT00750009 Phase 3
8 The Use of American Ginseng (Panax Quinquefolius) to Improve Cancer-Related Fatigue: A Randomized, Double-Blind, Placebo-Controlled Phase III Study Completed NCT00719563 Phase 3 American ginseng
9 The Use of Topical Baclofen, Amitriptyline HCI, and Ketamine (BAK) in a PLO Gel vs. Placebo for the Treatment of Chemotherapy Induced Peripheral Neuropathy: A Phase III Randomized Double-Blind Placebo Controlled Study Completed NCT00516503 Phase 3 baclofen/amitriptyline/ketamine gel
10 Randomized Placebo Controlled Double Blind Study of Restasis Versus Placebo in Primary Prevention of Ocular GVHD After Allogeneic Stem Cell Transplantation Completed NCT00755040 Phase 3 cyclosporine ophthalmic emulsion
11 HSCT-CHESS to Enhance Hematopoietic Transplant Recovery Completed NCT00782145 Phase 3
12 A Randomized Multicentre Study Comparing G-CSF Mobilized Peripheral Blood and G-CSF Stimulated Bone Marrow in Patients Undergoing Matched Sibling Transplantation for Hematologic Malignancies Completed NCT00438958 Phase 3
13 A Phase III Randomized, Double-Blind, Placebo-Controlled Study to Evaluate the Effects of Fragmin (5,000 IU Subcutaneously) in Preventing Catheter-Related Complications When Given Daily to Cancer Patients With Central Venous Catheters Completed NCT00006083 Phase 3 Fragmin
14 A PROSPECTIVE RANDOMIZED, DOUBLE-BLIND, COMPARATIVE, MULTICENTER STUDY TO EVALUATE EFFICACY AND SAFETY OF NYSTATIN AND AMPHOTERICIN B FOR EMPIRIC ANTIFUNGAL TREATMENT IN NEUTROPENIC PATIENTS Completed NCT00002742 Phase 3 amphotericin B deoxycholate;nystatin
15 A Phase III Randomized, Multicenter Trial Comparing G-CSF Mobilized Peripheral Blood Stem Cell With Marrow Transplantation From Human Leukocyte Antigen (HLA) Compatible Unrelated Donors (BMT CTN #0201) Completed NCT00075816 Phase 3
16 Phase III, Randomized, Double-Blind, Placebo-Controlled Crossover Trial of Ondansetron in the Control of Chronic Nausea and Vomiting Not Due to Antineoplastic Therapy in Patients With Advanced Cancer Completed NCT00006348 Phase 3 ondansetron
17 Allogeneic Blood or Marrow Transplantation for Hematologic Malignancy and Aplastic Anemia Completed NCT00003816 Phase 2, Phase 3 busulfan;carboplatin;cyclophosphamide;etoposide;fludarabine phosphate;melphalan;thiotepa
18 A Phase III Randomized Double-Blind Study of Erythropoietin Versus Placebo in Anemic Patients With Cancer Undergoing Chemotherapy Completed NCT00003600 Phase 3
19 Does Hypericum Reduce Fatigue in Cancer Patients on Chemotherapy? A Randomized, Double-Blind, Placebo-Controlled Clinical Trial Completed NCT00005805 Phase 3
20 A Phase III Double-Blind Equivalence Study of Two Different Formulations of Slow-Release Morphine Followed by a Randomization Between Dextromethorphan or Placebo Plus Statex SR for Chronic Cancer Pain Relief in Terminally Ill Patients Completed NCT00003687 Phase 3 dextromethorphan hydrobromide;morphine sulfate
21 INSPIRE: An Internet-based RCT for Long-term Survivors of Hematopoietic Stem Cell Transplantation Completed NCT00799461 Phase 3
22 Protocol for Patients With High Risk (Resistant, Refractory, Relapsed or Adverse Cytogenetic) AML Completed NCT00005863 Phase 3 cytarabine;daunorubicin hydrochloride;etoposide;fludarabine phosphate;tretinoin
23 A Multi-center Phase III Study Comparing Nonmyeloablative Conditioning With TBI Versus Fludarabine/TBI for HLA-matched Related Hematopoietic Cell Transplantation for Treatment of Hematologic Malignancies Completed NCT00075478 Phase 3 Fludarabine Phosphate;Mycophenolate Mofetil;Cyclosporine
24 Treatment of Children With Down Syndrome (DS) and Acute Myeloid Leukemia (AML), Myelodysplastic Syndrome (MDS), and Transient Myeloproliferative Disorder (TMD): A Phase III Group-Wide Study Completed NCT00003593 Phase 3 asparaginase;cytarabine;daunorubicin hydrochloride;methotrexate;therapeutic hydrocortisone;thioguanine
25 A Multi-center Phase III Study Comparing Myeloablative to Nonmyeloablative Transplant Conditioning in Patients With Myelodysplastic Syndrome or Acute Myelogenous Leukemia Completed NCT00322101 Phase 3 cyclophosphamide;mycophenolate mofetil;busulfan;cyclosporine;fludarabine phosphate;tacrolimus;methotrexate
26 Phase III Trial of T Lymphocyte Depletion by Elutriation and CD34 Add-Back for Allogeneic Bone Marrow Transplantation Completed NCT00265837 Phase 3
27 A Randomized Trial for Patients With Acute Myeloid Leukemia or High Risk Myelodysplatic Syndrome Aged 60 or Over Completed NCT00005823 Phase 3 cytarabine;daunorubicin hydrochloride;etoposide;hydroxyurea;idarubicin;mitoxantrone hydrochloride;thioguanine;tretinoin;valspodar
28 A Randomized, Double-blind, Placebo-controlled Study of the JAK Inhibitor INCB018424 Tablets Administered Orally to Subjects With Primary Myelofibrosis, Post-Polycythemia Vera Myelofibrosis or Post-Essential Thrombocythemia Myelofibrosis Completed NCT00952289 Phase 3 Ruxolitinib;Placebo
29 A Randomized Phase III Study to Determine the Most Promising Postgrafting Immunosuppression for Prevention of Acute GVHD After Unrelated Donor Hematopoietic Cell Transplantation Using Nonmyeloablative Conditioning for Patients With Hematologic Malignancies: A Multi-center Trial Completed NCT01231412 Phase 3 Cyclosporine;Fludarabine Phosphate;Mycophenolate Mofetil;Sirolimus
30 A Randomized Double Blinded Trial of Topical Caphosol to Prevent Oral Mucositis in Children Undergoing Hematopoietic Stem Cell Transplantation Completed NCT01305200 Phase 3 supersaturated calcium phosphate rinse
31 A Phase-3, Multi-Center, Randomized, Double-Blind, Placebo-Controlled, Parallel-Group Study to Compare Efficacy and Safety of Pomalidomide in Subjects With Myeloproliferative Neoplasm-Associated Myelofibrosis and Red Blood Cell-Transfusion-Dependence Completed NCT01178281 Phase 3 Pomalidomide 0.5 mg;Placebo;Pomalidomide
32 A Phase 3, Double-blind, Randomized Study to Compare the Efficacy and Safety of Luspatercept (ACE-536) Versus Placebo in Subjects With Myeloproliferative Neoplasm-Associated Myelofibrosis on Concomitant JAK Inhibitor Therapy and Who Require Red Blood Cell Transfusions Recruiting NCT04717414 Phase 3 ACE-536
33 Aprepitant Versus Hydroxyzine in Association With Cytoreductive Treatments for Patients With Myeloproliferative Neoplasia Suffering From Persistent Aquagenic Pruritus. Recruiting NCT03808805 Phase 3 Aprepitant 80 mg;Hydroxyzine 25mg;Placebo of Hydroxyzine;Placebo of Aprepitant
34 A Phase 3b, Open-label, Single-arm, Rollover Study to Evaluate Long-term Safety in Subjects Who Have Participated in Other Luspatercept (ACE-536) Clinical Trials Recruiting NCT04064060 Phase 3 Luspatercept
35 AVAJAK: Apixaban/Rivaroxaban Versus Aspirin for Primary Prevention of Thrombo-embolic Complications in JAK2V617F-positive Myeloproliferative Neoplasms Recruiting NCT05198960 Phase 3 Direct Oral Anticoagulants;Low-dose aspirin
36 Haploidentical Allogeneic Peripheral Blood Transplantation: Clinical Trial and Laboratory Correlates Examining Checkpoint Immune Regulators' Expression Recruiting NCT03480360 Phase 3 Cyclophosphamide;Fludarabine;Tacrolimus;cellcept;g-csf
37 PRO#1278: A Phase III Study of Fludarabine and Busulfan Versus Fludarabine, Busulfan and Low Dose Total Body Irradiation in Patients Receiving an Allogeneic Hematopoietic Stem Cell Transplant Active, not recruiting NCT01366612 Phase 3 Fludarabine and Busulfan plus/minus Total Body Irradiation (low dose);Fludarabine and Busulfan + Low Dose Total Body Irradiation (LD TBI)
38 Tacrolimus, Mini-dose Methotrexate and Mycophenolate Mofetil Versus Tacrolimus and Methotrexate for the Prevention of Acute Graft-versus-Host-Disease Active, not recruiting NCT01951885 Phase 3 tacrolimus;methotrexate;Mycophenolate mofetil;Methotrexate (low dose)
39 Risk-Stratified Therapy for Acute Myeloid Leukemia in Down Syndrome Active, not recruiting NCT02521493 Phase 3 Asparaginase;Asparaginase Erwinia chrysanthemi;Cytarabine;Daunorubicin Hydrochloride;Etoposide;Mitoxantrone Hydrochloride;Thioguanine
40 The Promoting Resilience in Stress Management (PRISM) Intervention: a Multi-site Randomized Controlled Trial for Adolescents and Young Adults Receiving Hematopoietic Cell Transplantation Active, not recruiting NCT03640325 Phase 3
41 An Open-label, Uncontrolled, Multicenter, Multinational Study on the Efficacy and Safety of Administration of Donor Lymphocytes Depleted of Alloreactive T-cells (ATIR), Through the Use of TH9402 and Light Treatment in an ex Vivo Process, in Patients Receiving a CD34-selected Peripheral Blood Stem Cell Graft From a Related, Haploidentical Donor Terminated NCT00967343 Phase 2, Phase 3
42 Randomized, Double Blinded, Placebo-Controlled Trial of Antibacterial Prophylaxis for the Prevention of Bacterial Infections in the Post-Engraftment Phase After Allogeneic Hematopoeitic Stem Cell Transplantation Terminated NCT00324324 Phase 3 moxifloxacin hydrochloride;Placebo
43 Randomized Study to Compare Post Bone Marrow Transplant Cyclophosphamide With the Combination of Methotrexate Plus Calcineurin Inhibitor for Graft Versus Host Disease Prophylaxis Terminated NCT01749111 Phase 3 ARM A Cyclophosphamide;ARM B Calcineurin inhibitor and methotrexate
44 Treatment of Transient Myeloproliferative Disorder (TMD) in Children With Down Syndrome (DS) Withdrawn NCT00411281 Phase 3 cytarabine
45 A Multiinstitutional Trial To Evaluate The Prophylactic Use Of NASA-Developed Light Emitting Diodes For The Prevention Of Oral Mucositis In Bone Marrow Transplant Patients Unknown status NCT00036712 Phase 2
46 Open Label Pilot Phase II Study of STI571 in the Treatment of Patients With Idiopathic Hypereosinophilic Syndrome (HES) and Eosinophilic Leukemias Unknown status NCT00276926 Phase 2 STI571
47 A Phase 1b/2 Study to Evaluate the Safety and Efficacy of APR-246 in Combination With Azacitidine for the Treatment of Mutation TP53 (TP53) Mutant Myeloid Neoplasms Unknown status NCT03588078 Phase 1, Phase 2 APR-246;Azacitidine
48 Transplantation Using Umbilical Cord And Placental Blood Unknown status NCT00008164 Phase 2
49 Dual Vaccine Trial in Myeloproliferative Neoplasms Unknown status NCT04051307 Phase 1, Phase 2 PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL;Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
50 The Efficacy of Velcade on Bone Tissue During Myelomatosis (Bone Marrow Cancer) Completed NCT00436059 Phase 2 bortezomib

Search NIH Clinical Center for Bone Marrow Cancer

Inferred drug relations via UMLS 71 / NDF-RT 50 :


Sodium phenylbutyrate

Cochrane evidence based reviews: myeloproliferative disorders

Genetic Tests for Bone Marrow Cancer

Anatomical Context for Bone Marrow Cancer

Organs/tissues related to Bone Marrow Cancer:

MalaCards : Bone Marrow, Bone, Myeloid, T Cells, Kidney, Lymph Node, Breast

Publications for Bone Marrow Cancer

Articles related to Bone Marrow Cancer:

(show top 50) (show all 172)
# Title Authors PMID Year
1
A systematic review of recent trends in research on therapeutically significant L-asparaginase and acute lymphoblastic leukemia. 62
35816224 2022
2
Changes in Bone Marrow Tumor and Immune Cells Correlate with Durability of Remissions Following BCMA CAR T Therapy in Myeloma. 62
36026513 2022
3
Bone Marrow Endothelial Cells Increase Prostate Cancer Cell Apoptosis in 3D Triculture Model of Reactive Stroma. 62
36138750 2022
4
Treatment of chemotherapy-induced thrombocytopenia in patients with non-hematologic malignancies. 62
35642485 2022
5
Frailty-adjusted therapy in Transplant Non-Eligible patients with newly diagnosed Multiple Myeloma (FiTNEss (UK-MRA Myeloma XIV Trial)): a study protocol for a randomised phase III trial. 62
35654466 2022
6
Cellular senescence in cancers: relationship between bone marrow cancer and cellular senescence. 62
35449316 2022
7
CXCR4 and anti-BCMA CAR co-modified natural killer cells suppress multiple myeloma progression in a xenograft mouse model. 62
34471234 2022
8
Enrichment-Free Single-Cell Detection and Morphogenomic Profiling of Myeloma Patient Samples to Delineate Circulating Rare Plasma Cell Clones. 62
35621632 2022
9
Natural killer cells activity against multiple myeloma cells is modulated by osteoblast-induced IL-6 and IL-10 production. 62
35846441 2022
10
ADRB3 induces mobilization and inhibits differentiation of both breast cancer cells and myeloid-derived suppressor cells. 62
35145073 2022
11
Correlation of Cytokine Release Syndrome With Prognosis After Chimeric Antigen Receptor T Cell Therapy: Analysis of 54 Patients With Relapsed or Refractory Multiple Myeloma. 62
35572513 2022
12
Vγ9Vδ2 T cells expressing a BCMA-Specific chimeric antigen receptor inhibit multiple myeloma xenograft growth. 62
35709135 2022
13
Clinical characteristics of COVID-19-infected cancer patients, Isfahan, Iran. 62
36353349 2022
14
Metabolic Disorders in Multiple Myeloma. 62
34768861 2021
15
Combination Therapy of Navitoclax with Chemotherapeutic Agents in Solid Tumors and Blood Cancer: A Review of Current Evidence. 62
34575429 2021
16
A multicenter study of romiplostim for chemotherapy-induced thrombocytopenia in solid tumors and hematologic malignancies. 62
32499239 2021
17
Association of RANK and RANKL gene polymorphism with survival and calcium levels in multiple myeloma. 62
33283899 2021
18
Withanolide-Type Steroids from Withania aristata as Potential Anti-Leukemic Agents. 62
33291428 2020
19
Antimyeloma Potential of Caffeic Acid Phenethyl Ester and Its Analogues through Sp1 Mediated Downregulation of IKZF1-IRF4-MYC Axis. 62
33210536 2020
20
Adaptation and Evaluation of a Symptom-Monitoring Digital Health Intervention for Patients With Relapsed and Refractory Multiple Myeloma: Pilot Mixed-Methods Implementation Study. 62
33200997 2020
21
Primary bone lymphoma: pictorial essay. 62
33304011 2020
22
Strategic use of patent opposition safeguard to improve equitable access to innovative health technologies: A case study of CAR T-cell therapy Kymriah. 62
33031009 2020
23
89Zr-pembrolizumab biodistribution is influenced by PD-1-mediated uptake in lymphoid organs. 62
33020241 2020
24
Amides as bioisosteres of triazole-based geranylgeranyl diphosphate synthase inhibitors. 62
32690260 2020
25
Proteosomal degradation of NSD2 by BRCA1 promotes leukemia cell differentiation. 62
32826945 2020
26
GRASP55 Is Dispensable for Normal Hematopoiesis but Necessary for Myc-Dependent Leukemic Growth. 62
32229537 2020
27
Epigenetic control of the EWS‑FLI1 promoter in Ewing's sarcoma. 62
32323788 2020
28
[Clinical Efficacy and Prognostic Factors of Newly Diagnosed Children[JP] with Burkitt Lymphoma Treated by High-Dose and Short-Course Modified LMB Regimen ± Rituximab]. 62
32319391 2020
29
Specific Features of Interactions between Megakaryocytic and Granulocytic Hematopoiesis Lineages and Myelofibrosis during the Acute Phase of Chronic Myeloid Leukemia, Chronic Lymphocytic Leukemia, and Multiple Myeloma. 62
32333309 2020
30
High-risk smoldering myeloma versus early detection of multiple myeloma: Current models, goals of therapy, and clinical implications. 62
32139017 2020
31
Proteasome inhibition in multiple myeloma: lessons for other cancers. 62
31875696 2020
32
Leveraging RSF and PET images for prognosis of multiple myeloma at diagnosis. 62
31256359 2020
33
Prolonged Response of a Patient with Relapsed Acute Myeloid Leukemia to a Novel Oral Bromodomain Extraterminal Inhibitor (BETi). 62
33381331 2020
34
Ligand-Receptor Interactions of Galectin-9 and VISTA Suppress Human T Lymphocyte Cytotoxic Activity. 62
33329552 2020
35
Exploration of quinolone and quinoline derivatives as potential anticancer agents. 62
31410781 2019
36
Multi-organ system for the evaluation of efficacy and off-target toxicity of anticancer therapeutics. 62
31217335 2019
37
Methylation and PTEN activation in dental pulp mesenchymal stem cells promotes osteogenesis and reduces oncogenesis. 62
31110221 2019
38
Single-cell imaging of CAR T cell activity in vivo reveals extensive functional and anatomical heterogeneity. 62
30936262 2019
39
[Consistency Analysis of Gene Mutation Sites of Bone Marrow Tumor DNA and Circulating Tumor DNA in Patients with Myelodysplastic Syndrome]. 62
30738462 2019
40
Liposomal dexamethasone inhibits tumor growth in an advanced human-mouse hybrid model of multiple myeloma. 62
30682443 2019
41
Persistent Exposure to Fusobacterium nucleatum Triggers Chemokine/Cytokine Release and Inhibits the Proliferation and Osteogenic Differentiation Capabilities of Human Gingiva-Derived Mesenchymal Stem Cells. 62
31921705 2019
42
Health-related quality of life in acute myeloid leukemia patients not eligible for intensive chemotherapy: results of a systematic literature review. 62
30679915 2019
43
Dural Cells Release Factors Which Promote Cancer Cell Malignancy and Induce Immunosuppressive Markers in Bone Marrow Myeloid Cells. 62
29462368 2018
44
Biochemical mechanisms implemented by human acute myeloid leukemia cells to suppress host immune surveillance. 62
29872115 2018
45
Distinctive inhibition of alkaline phosphatase isozymes by thiazol-2-ylidene-benzamide derivatives: Functional insights into their anticancer role. 62
29363794 2018
46
Detailed investigation of anticancer activity of sulfamoyl benz(sulfon)amides and 1H-pyrazol-4-yl benzamides: An experimental and computational study. 62
29763580 2018
47
The Lipid Side of Bone Marrow Adipocytes: How Tumor Cells Adapt and Survive in Bone. 62
29869753 2018
48
Immune cell contexture in the bone marrow tumor microenvironment impacts therapy response in CML. 62
29925907 2018
49
[Clinical features and prognosis of children with mature B-cell non-Hodgkin's lymphoma: an analysis of 28 cases]. 62
29972121 2018
50
Mesenchymal Stromal Cells: Emerging Roles in Bone Metastasis. 62
29642534 2018

Variations for Bone Marrow Cancer

Expression for Bone Marrow Cancer

Search GEO for disease gene expression data for Bone Marrow Cancer.

Pathways for Bone Marrow Cancer

Pathways related to Bone Marrow Cancer according to GeneCards Suite gene sharing:

# Super pathways Score Top Affiliating Genes
1 11.38 MIR221 MIR21 MIR181A1 MIR17 MIR145
2 11.23 MIR9-1 MIR21 MIR199A1 MIR155 MIR145 MIR126
3
Show member pathways
11.06 MIR9-1 MIR221 MIR199A1 MIR181A1 MIR17 MIR155

GO Terms for Bone Marrow Cancer

Cellular components related to Bone Marrow Cancer according to GeneCards Suite gene sharing:

# Name GO ID Score Top Affiliating Genes
1 RISC complex GO:0016442 9.7 MIR9-1 MIR221 MIR21 MIR199A1 MIR181A1 MIR17
2 extracellular vesicle GO:1903561 9.43 MIR34A MIR221 MIR21 MIR17 MIR126 MIR125A

Biological processes related to Bone Marrow Cancer according to GeneCards Suite gene sharing:

(show all 24)
# Name GO ID Score Top Affiliating Genes
1 cellular response to hypoxia GO:0071456 9.89 MIR34A MIR17 MIR140 MIR126
2 positive regulation of protein kinase B signaling GO:0051897 9.88 MIR221 MIR21 MIR199A1 MIR126
3 negative regulation of angiogenesis GO:0016525 9.86 MIR34A MIR21 MIR145 MIR125A
4 negative regulation of gene expression GO:0010629 9.86 MIR9-1 MIR34A MIR21 MIR199A1 MIR17 MIR155
5 negative regulation of cell migration GO:0030336 9.85 MIR9-1 MIR34A MIR21 MIR145 MIR126
6 negative regulation of inflammatory response GO:0050728 9.8 MIR221 MIR199A1 MIR145 MIR142 MIR126
7 negative regulation of osteoblast differentiation GO:0045668 9.79 MIR9-1 MIR17 MIR140
8 positive regulation of vascular associated smooth muscle cell proliferation GO:1904707 9.77 JAK2 MIR17 MIR21 MIR221
9 negative regulation of cytokine production involved in inflammatory response GO:1900016 9.72 MIR125A MIR140 MIR221
10 negative regulation of cardiac muscle cell apoptotic process GO:0010667 9.72 MIR21 MIR199A1 MIR145 JAK2
11 miRNA-mediated gene silencing GO:0035195 9.68 MIR9-1 MIR34A MIR221 MIR21 MIR199A1 MIR181A1
12 negative regulation of sprouting angiogenesis GO:1903671 9.67 MIR34A MIR221 MIR17
13 negative regulation of vascular associated smooth muscle cell migration GO:1904753 9.65 MIR34A MIR21 MIR140
14 miRNA-mediated gene silencing by inhibition of translation GO:0035278 9.63 MIR9-1 MIR221 MIR21 MIR17 MIR145 MIR126
15 positive regulation of connective tissue replacement GO:1905205 9.61 MIR34A MIR199A1
16 positive regulation of cardiac muscle hypertrophy in response to stress GO:1903244 9.61 MIR199A1 MIR17
17 negative regulation of vascular associated smooth muscle cell apoptotic process GO:1905460 9.6 MIR21 MIR17
18 positive regulation of metalloendopeptidase activity GO:1904685 9.58 MIR21 MIR17
19 negative regulation of leukocyte adhesion to vascular endothelial cell GO:1904995 9.57 MIR221 MIR125A
20 negative regulation of BMP secretion GO:2001285 9.54 MIR17 MIR140
21 negative regulation of interleukin-21 production GO:0032705 9.52 MIR221 MIR21
22 positive regulation of cellular response to hypoxia GO:1900039 9.51 MIR21 MIR145
23 negative regulation of interleukin-16 production GO:0032699 9.43 MIR145 MIR125A
24 negative regulation of vascular endothelial growth factor production GO:1904046 9.35 MIR125A MIR140 MIR17 MIR199A1 MIR34A

Molecular functions related to Bone Marrow Cancer according to GeneCards Suite gene sharing:

# Name GO ID Score Top Affiliating Genes
1 mRNA 3'-UTR binding GO:0003730 9.7 MIR9-1 MIR34A MIR21 MIR199A1 MIR17 MIR155
2 mRNA base-pairing translational repressor activity GO:1903231 9.4 MIR9-1 MIR34A MIR221 MIR21 MIR199A1 MIR17

Sources for Bone Marrow Cancer

2 CDC
6 CNVD
8 Cosmic
9 dbSNP
10 DGIdb
16 EFO
17 ExPASy
18 FMA
19 GARD
27 GO
28 GTR
29 HMDB
30 HPO
31 ICD10
32 ICD10 via Orphanet
33 ICD11
34 ICD9CM
35 IUPHAR
36 LifeMap
38 LOVD
40 MedGen
43 MeSH
44 MESH via Orphanet
45 MGI
48 NCI
49 NCIt
50 NDF-RT
52 NINDS
53 Novoseek
55 ODiseA
56 OMIM via Orphanet
57 OMIM® (Updated 08-Dec-2022)
61 PubChem
62 PubMed
64 QIAGEN
69 SNOMED-CT via HPO
70 Tocris
71 UMLS
72 UMLS via Orphanet
Content
Loading form....