Bone Marrow Cancer disease: Malacards - Research Articles, Drugs, Genes, Clinical Trials

MCID: BNM001 MIFTS: 44	Bone Marrow Cancer Categories: Blood diseases, Bone diseases, Cancer diseases, Immune diseases	Data Licensing For inquiries, contact: [email protected]
Genes Tissues Related diseases Publications Drugs Expand all tables

Sources

Aliases & Classifications for Bone Marrow Cancer

MalaCards integrated aliases for Bone Marrow Cancer:

Name: Bone Marrow Cancer ¹¹ ¹⁴

Malignant Neoplasm of Bone Marrow ¹¹ ⁷¹

Chronic Myeloproliferative Disorder ⁷¹

Myeloproliferative Disorders ⁴³

Malignant Bone Marrow Tumor ¹¹

Myeloproliferative Disease ⁷¹

Bone Marrow Neoplasms ⁷¹

Bone Marrow Neoplasm ¹¹

Bone-Marrow Cancer ⁷⁵

Bone Marrow Tumor ¹¹

Classifications:

MalaCards categories:
Global: Cancer diseases
Anatomical: Blood diseases Bone diseases Immune diseases

See all MalaCards categories (disease lists)

ICD10: ³¹

Neoplasms

Neoplasms of uncertain or unknown behaviour

Other neoplasms of uncertain or unknown behaviour of lymphoid, haematopoietic and related tissue

Chronic myeloproliferative disease

External Ids:

Disease Ontology ¹¹ DOID:4960

MeSH ⁴³ D009196

SNOMED-CT ⁶⁸ 128925001

ICD10 ³¹ D47.1

UMLS ⁷¹ C0027022 C0282609 C1292778 more

Sources

Summaries for Bone Marrow Cancer

Disease Ontology: ¹¹ A hematopoietic cancer that derives from the blood-forming stem cells of the bone marrow.

MalaCards based summary: Bone Marrow Cancer, also known as malignant neoplasm of bone marrow, is related to myeloproliferative neoplasm and essential thrombocythemia. An important gene associated with Bone Marrow Cancer is U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1), and among its related pathways/superpathways are miRNAs involved in DNA damage response and miRNAs involvement in the immune response in sepsis. The drugs Thalidomide and Amitriptyline have been mentioned in the context of this disorder. Affiliated tissues include bone marrow, bone and myeloid.

Wikipedia: ⁷⁵ Multiple myeloma (MM), also known as plasma cell myeloma and simply myeloma, is a cancer of plasma... more...

Sources

Related Diseases for Bone Marrow Cancer

Diseases related to Bone Marrow Cancer via text searches within MalaCards or GeneCards Suite gene sharing:

(show top 50) (show all 584)

#	Related Disease	Score	Top Affiliating Genes
1	myeloproliferative neoplasm	33.4	U2AF1 MIR155 LUC7L2 KDM4C JAK2 H2AC18
2	essential thrombocythemia	32.4	U2AF1 LUC7L2 JAK2 H2AC18
3	myelodysplastic/myeloproliferative neoplasm	32.4	U2AF1 LUC7L2 JAK2
4	myelodysplastic syndrome	32.3	U2AF1 MIR9-1 MIR34A MIR221 MIR199A1 MIR17
5	chronic myelomonocytic leukemia	31.7	U2AF1 LUC7L2 KDM4C JAK2 H2AC18
6	leukemia, acute myeloid	31.5	U2AF1 MIR9-1 MIR34A MIR221 MIR21 MIR199A1
7	blood platelet disease	31.3	U2AF1 MIR142 LUC7L2 JAK2 ICOSLG H2AC18
8	atypical chronic myeloid leukemia, bcr-abl1 negative	31.3	U2AF1 LUC7L2 JAK2
9	acute erythroid leukemia	31.2	U2AF1 KDM4C JAK2 H2AC18
10	deficiency anemia	31.2	U2AF1 MIR126 LUC7L2 JAK2 ICOSLG H2AC18
11	chronic neutrophilic leukemia	31.2	U2AF1 LUC7L2 JAK2
12	leukemia, acute lymphoblastic	31.1	U2AF1 MIR9-1 MIR221 MIR21 MIR199A1 MIR181A1
13	lymphoma, hodgkin, classic	31.0	MIR9-1 MIR21 MIR155 MIR140 KDM4C JAK2
14	hematologic cancer	31.0	U2AF1 MIR9-1 MIR34A MIR221 MIR21 MIR199A1
15	neutrophilia, hereditary	31.0	U2AF1 LUC7L2 JAK2
16	leukemia, chronic lymphocytic	30.9	U2AF1 MIR9-1 MIR34A MIR221 MIR21 MIR199A1
17	chronic leukemia	30.9	U2AF1 LUC7L2 KDM4C JAK2 H2AC18
18	portal hypertension	30.9	MIR199A1 JAK2 CCR6
19	thrombocytopenia due to platelet alloimmunization	30.9	U2AF1 ICOSLG CCR6
20	hypertension, essential	30.8	MIR9-1 MIR34A MIR221 MIR21 MIR199A1 MIR181A1
21	acquired von willebrand syndrome	30.8	U2AF1 JAK2
22	vascular disease	30.8	MIR21 MIR199A1 MIR145 MIR126 MIR125A
23	allergic disease	30.7	MIR21 MIR155 ICOSLG H2AC18 CCR6
24	viral infectious disease	30.7	MIR21 MIR199A1 MIR155 ICOSLG H2AC18 CCR6
25	mantle cell lymphoma	30.6	U2AF1 MIR9-1 MIR17 MIR155 KDM4C ICOSLG
26	neuroblastoma	30.5	MIR34A MIR221 MIR21 MIR181A1 MIR17 MIR145
27	peripheral artery disease	30.5	MIR21 MIR199A1 MIR17 MIR126
28	intermediate coronary syndrome	30.5	MIR21 MIR17 MIR145 MIR142 MIR126
29	systemic scleroderma	30.5	MIR21 MIR142 ICOSLG H2AC18 CCR6
30	microvascular complications of diabetes 5	30.5	MIR21 MIR199A1 MIR17 MIR126 H2AC18
31	aplastic anemia	30.5	U2AF1 LUC7L2 H2AC18 CCR6
32	leukemia, chronic myeloid	30.5	U2AF1 MIR9-1 MIR199A1 MIR17 MIR155 MIR142
33	exanthem	30.4	ICOSLG H2AC18 CCR6
34	myelophthisic anemia	30.4	U2AF1 JAK2
35	leukemia, acute monocytic	30.4	U2AF1 MIR155 H2AC18
36	acute promyelocytic leukemia	30.4	U2AF1 MIR9-1 MIR221 MIR181A1 MIR17 MIR126
37	gastrointestinal stromal tumor	30.4	U2AF1 MIR199A1 JAK2 H2AC18
38	parkinson disease, late-onset	30.4	MIR9-1 MIR21 MIR155 MIR142 MIR126 MIR125A
39	myeloma, multiple	30.4	U2AF1 MIR9-1 MIR221 MIR21 MIR199A1 MIR181A1
40	alzheimer disease, familial, 1	30.4	MIR9-1 MIR34A MIR21 MIR199A1 MIR181A1 MIR17
41	sm-ahnmd	30.4	U2AF1 JAK2
42	lipoprotein quantitative trait locus	30.3	MIR34A MIR221 MIR21 MIR199A1 MIR181A1 MIR17
43	cerebrovascular disease	30.3	MIR9-1 MIR221 MIR21 MIR199A1 MIR181A1 MIR17
44	ewing sarcoma	30.3	MIR9-1 MIR199A1 KDM4C H2AC18
45	breast cancer	30.3	MIR9-1 MIR34A MIR221 MIR21 MIR199A1 MIR181A1
46	skin disease	30.3	U2AF1 MIR9-1 MIR34A MIR221 MIR21 MIR199A1
47	arteries, anomalies of	30.3	MIR9-1 MIR34A MIR221 MIR21 MIR199A1 MIR181A1
48	lung cancer	30.3	U2AF1 MIR9-1 MIR34A MIR221 MIR21 MIR199A1
49	diamond-blackfan anemia	11.1
50	juvenile myelomonocytic leukemia	11.1

Graphical network of the top 20 diseases related to Bone Marrow Cancer:

Sources

Symptoms & Phenotypes for Bone Marrow Cancer

Sources

Drugs & Therapeutics for Bone Marrow Cancer

Drugs for Bone Marrow Cancer (from DrugBank, HMDB, Dgidb, PharmGKB, IUPHAR, NovoSeek, BitterDB):

(show top 50) (show all 433)

Name

Status

Phase

Clinical Trials

Cas Number

PubChem Id

Thalidomide

Approved, Investigational, Withdrawn

Phase 3

50-35-1

5426

Amitriptyline

Approved

Phase 3

50-48-6

2160

Baclofen

Approved

Phase 3

1134-47-0

2284

Ketamine

Approved, Vet_approved

Phase 3

6740-88-1, 1867-66-9

3821

Pomalidomide

Approved

Phase 3

19171-19-8

134780

Ondansetron

Approved, Withdrawn

Phase 3

99614-02-5

4595

Morphine

Approved, Investigational

Phase 3

57-27-2

5288826

Sirolimus

Approved, Investigational

Phase 3

53123-88-9

5284616 6436030

Reviparin

Approved, Investigational

Phase 3

9041-08-1

Amphotericin B

Approved, Investigational

Phase 3

1397-89-3

5280965

Nystatin

Approved, Vet_approved

Phase 3

1400-61-9

11953884

Deoxycholic acid

Approved

Phase 3

83-44-3

222528

Dextromethorphan

Approved

Phase 3

125-71-3

5362449 5360696

Hydrocortisone succinate

Approved

Phase 3

2203-97-6

3643

Hydrocortisone acetate

Approved, Vet_approved

Phase 3

50-03-3

Hydrocortisone

Approved, Vet_approved

Phase 3

50-23-7

3640 5754

Luspatercept

Approved, Investigational

Phase 3

1373715-00-4

Aprepitant

Approved, Investigational

Phase 3

170729-80-3

6918365 135413536

Crofelemer

Approved

Phase 3

33507-63-0, 148465-45-6

36511 44359816

Fosaprepitant

Approved

Phase 3

172673-20-0

219090 135413538

Sodium citrate

Approved, Investigational

Phase 3

68-04-2

23431961

Acetylsalicylic acid

Approved, Vet_approved

Phase 3

50-78-2

2244

Hydroxyzine

Approved

Phase 3

68-88-2

3658

Histamine

Approved, Investigational

Phase 3

51-45-6

774

Apixaban

Approved

Phase 3

503612-47-3

10182969

Rivaroxaban

Approved

Phase 3

366789-02-8

9875401

Etoposide

Approved

Phase 3

33419-42-0

36462

Triamcinolone

Approved, Vet_approved

Phase 3

124-94-7

31307

Daunorubicin

Approved

Phase 3

20830-81-3

30323

Picropodophyllin

Approved, Investigational

Phase 3

518-28-5, 477-47-4

10607 72435

Mitoxantrone

Approved, Investigational

Phase 3

70476-82-3, 65271-80-9

4212

Asparaginase Escherichia coli

Approved, Investigational

Phase 3

9015-68-3

Mercaptopurine

Approved

Phase 3

50-44-2

667490

Tioguanine

Approved

Phase 3

154-42-7

2723601

Cyclophosphamide

Approved, Investigational

Phase 3

50-18-0, 6055-19-2

2907

Levoleucovorin

Approved, Experimental, Investigational

Phase 3

68538-85-2, 58-05-9, 73951-54-9

149436 6006

Methotrexate

Approved

Phase 3

1959-05-2, 59-05-2

4112 126941

Tacrolimus

Approved, Investigational

Phase 3

104987-11-3

6473866 445643

Estradiol

Approved, Investigational, Vet_approved

Phase 3

50-28-2

5757

Ethinylestradiol

Approved

Phase 3

57-63-6

5991

Polyestradiol phosphate

Approved

Phase 3

28014-46-2

Norgestimate

Approved, Investigational

Phase 3

35189-28-7

6540478

Moxifloxacin

Approved, Investigational

Phase 3

186826-86-8, 354812-41-2, 151096-09-2

152946

Isotretinoin

Approved, Investigational, Nutraceutical

Phase 3

302-79-4, 4759-48-2

5538 444795 5282379

St. John's Wort

Approved, Investigational, Nutraceutical

Phase 3

84082-80-4

Citric acid

Approved, Nutraceutical, Vet_approved

Phase 3

77-92-9

311

Aspartic acid

Approved, Nutraceutical

Phase 3

56-84-8

5960

Asparagine

Approved, Investigational, Nutraceutical

Phase 3

70-47-3

6267

Folic acid

Approved, Nutraceutical, Vet_approved

Phase 3

59-30-3

6037

Anti-Bacterial Agents

Phase 3

Interventional clinical trials:

(show top 50) (show all 554)

#	Name	Status	NCT ID	Phase	Drugs
1	Busulfan Dose Escalation Study Based on AUC in the Setting of Busulfan/Fludarabine Conditioning Prior to Allogeneic Hematopoietic Cell Transplantation (HCT)	Completed	NCT00361140	Phase 4	Busulfan;Fludarabine
2	Laser Therapy Prevents Mucositis Oral in Patients Undergoing to Chemotherapy for Bone Marrow Transplantation? A Randomized Clinical Trial.	Unknown status	NCT02020928	Phase 3
3	Intravenous Low-Dose Decitabine Versus Supportive Care in Elderly Patients With Primary Myelodysplastic Syndrome (MDS) (>10% Blasts or High-Risk Cytogenetics), Secondary MDS or Chronic Myelomonocytic Leukemia (CMML) Who Are Not Eligible for Intensive Therapy: An EORTC-German MDS Study Group Randomized Phase III Study	Unknown status	NCT00043134	Phase 3	decitabine
4	Prospective Study of the Diagnosis and Treatment of Myelodysplastic Syndromes (MDS) in Childhood	Unknown status	NCT00047268	Phase 3	cytarabine;mercaptopurine
5	Evaluation of Plasmatic Levels of Busulfan in Patients Undergoing Hematopoietic Stem Cell Transplantation	Unknown status	NCT01800643	Phase 2, Phase 3
6	Phase III Randomized Trial of an Opioid Titration Order Sheet Compared to Standard of Care in Patients With Cancer Related Pain.	Completed	NCT00666211	Phase 3
7	Preparatory Aid to Improve Decision Making About Cancer Clinical Trials (PRE-ACT)	Completed	NCT00750009	Phase 3
8	The Use of American Ginseng (Panax Quinquefolius) to Improve Cancer-Related Fatigue: A Randomized, Double-Blind, Placebo-Controlled Phase III Study	Completed	NCT00719563	Phase 3	American ginseng
9	The Use of Topical Baclofen, Amitriptyline HCI, and Ketamine (BAK) in a PLO Gel vs. Placebo for the Treatment of Chemotherapy Induced Peripheral Neuropathy: A Phase III Randomized Double-Blind Placebo Controlled Study	Completed	NCT00516503	Phase 3	baclofen/amitriptyline/ketamine gel
10	Randomized Placebo Controlled Double Blind Study of Restasis Versus Placebo in Primary Prevention of Ocular GVHD After Allogeneic Stem Cell Transplantation	Completed	NCT00755040	Phase 3	cyclosporine ophthalmic emulsion
11	HSCT-CHESS to Enhance Hematopoietic Transplant Recovery	Completed	NCT00782145	Phase 3
12	A Randomized Multicentre Study Comparing G-CSF Mobilized Peripheral Blood and G-CSF Stimulated Bone Marrow in Patients Undergoing Matched Sibling Transplantation for Hematologic Malignancies	Completed	NCT00438958	Phase 3
13	A Phase III Randomized, Double-Blind, Placebo-Controlled Study to Evaluate the Effects of Fragmin (5,000 IU Subcutaneously) in Preventing Catheter-Related Complications When Given Daily to Cancer Patients With Central Venous Catheters	Completed	NCT00006083	Phase 3	Fragmin
14	A PROSPECTIVE RANDOMIZED, DOUBLE-BLIND, COMPARATIVE, MULTICENTER STUDY TO EVALUATE EFFICACY AND SAFETY OF NYSTATIN AND AMPHOTERICIN B FOR EMPIRIC ANTIFUNGAL TREATMENT IN NEUTROPENIC PATIENTS	Completed	NCT00002742	Phase 3	amphotericin B deoxycholate;nystatin
15	A Phase III Randomized, Multicenter Trial Comparing G-CSF Mobilized Peripheral Blood Stem Cell With Marrow Transplantation From Human Leukocyte Antigen (HLA) Compatible Unrelated Donors (BMT CTN #0201)	Completed	NCT00075816	Phase 3
16	Phase III, Randomized, Double-Blind, Placebo-Controlled Crossover Trial of Ondansetron in the Control of Chronic Nausea and Vomiting Not Due to Antineoplastic Therapy in Patients With Advanced Cancer	Completed	NCT00006348	Phase 3	ondansetron
17	Allogeneic Blood or Marrow Transplantation for Hematologic Malignancy and Aplastic Anemia	Completed	NCT00003816	Phase 2, Phase 3	busulfan;carboplatin;cyclophosphamide;etoposide;fludarabine phosphate;melphalan;thiotepa
18	A Phase III Randomized Double-Blind Study of Erythropoietin Versus Placebo in Anemic Patients With Cancer Undergoing Chemotherapy	Completed	NCT00003600	Phase 3
19	Does Hypericum Reduce Fatigue in Cancer Patients on Chemotherapy? A Randomized, Double-Blind, Placebo-Controlled Clinical Trial	Completed	NCT00005805	Phase 3
20	A Phase III Double-Blind Equivalence Study of Two Different Formulations of Slow-Release Morphine Followed by a Randomization Between Dextromethorphan or Placebo Plus Statex SR for Chronic Cancer Pain Relief in Terminally Ill Patients	Completed	NCT00003687	Phase 3	dextromethorphan hydrobromide;morphine sulfate
21	INSPIRE: An Internet-based RCT for Long-term Survivors of Hematopoietic Stem Cell Transplantation	Completed	NCT00799461	Phase 3
22	Protocol for Patients With High Risk (Resistant, Refractory, Relapsed or Adverse Cytogenetic) AML	Completed	NCT00005863	Phase 3	cytarabine;daunorubicin hydrochloride;etoposide;fludarabine phosphate;tretinoin
23	A Multi-center Phase III Study Comparing Nonmyeloablative Conditioning With TBI Versus Fludarabine/TBI for HLA-matched Related Hematopoietic Cell Transplantation for Treatment of Hematologic Malignancies	Completed	NCT00075478	Phase 3	Fludarabine Phosphate;Mycophenolate Mofetil;Cyclosporine
24	Treatment of Children With Down Syndrome (DS) and Acute Myeloid Leukemia (AML), Myelodysplastic Syndrome (MDS), and Transient Myeloproliferative Disorder (TMD): A Phase III Group-Wide Study	Completed	NCT00003593	Phase 3	asparaginase;cytarabine;daunorubicin hydrochloride;methotrexate;therapeutic hydrocortisone;thioguanine
25	A Multi-center Phase III Study Comparing Myeloablative to Nonmyeloablative Transplant Conditioning in Patients With Myelodysplastic Syndrome or Acute Myelogenous Leukemia	Completed	NCT00322101	Phase 3	cyclophosphamide;mycophenolate mofetil;busulfan;cyclosporine;fludarabine phosphate;tacrolimus;methotrexate
26	Phase III Trial of T Lymphocyte Depletion by Elutriation and CD34 Add-Back for Allogeneic Bone Marrow Transplantation	Completed	NCT00265837	Phase 3
27	A Randomized Trial for Patients With Acute Myeloid Leukemia or High Risk Myelodysplatic Syndrome Aged 60 or Over	Completed	NCT00005823	Phase 3	cytarabine;daunorubicin hydrochloride;etoposide;hydroxyurea;idarubicin;mitoxantrone hydrochloride;thioguanine;tretinoin;valspodar
28	A Randomized, Double-blind, Placebo-controlled Study of the JAK Inhibitor INCB018424 Tablets Administered Orally to Subjects With Primary Myelofibrosis, Post-Polycythemia Vera Myelofibrosis or Post-Essential Thrombocythemia Myelofibrosis	Completed	NCT00952289	Phase 3	Ruxolitinib;Placebo
29	A Randomized Phase III Study to Determine the Most Promising Postgrafting Immunosuppression for Prevention of Acute GVHD After Unrelated Donor Hematopoietic Cell Transplantation Using Nonmyeloablative Conditioning for Patients With Hematologic Malignancies: A Multi-center Trial	Completed	NCT01231412	Phase 3	Cyclosporine;Fludarabine Phosphate;Mycophenolate Mofetil;Sirolimus
30	A Randomized Double Blinded Trial of Topical Caphosol to Prevent Oral Mucositis in Children Undergoing Hematopoietic Stem Cell Transplantation	Completed	NCT01305200	Phase 3	supersaturated calcium phosphate rinse
31	A Phase-3, Multi-Center, Randomized, Double-Blind, Placebo-Controlled, Parallel-Group Study to Compare Efficacy and Safety of Pomalidomide in Subjects With Myeloproliferative Neoplasm-Associated Myelofibrosis and Red Blood Cell-Transfusion-Dependence	Completed	NCT01178281	Phase 3	Pomalidomide 0.5 mg;Placebo;Pomalidomide
32	A Phase 3, Double-blind, Randomized Study to Compare the Efficacy and Safety of Luspatercept (ACE-536) Versus Placebo in Subjects With Myeloproliferative Neoplasm-Associated Myelofibrosis on Concomitant JAK Inhibitor Therapy and Who Require Red Blood Cell Transfusions	Recruiting	NCT04717414	Phase 3	ACE-536
33	Aprepitant Versus Hydroxyzine in Association With Cytoreductive Treatments for Patients With Myeloproliferative Neoplasia Suffering From Persistent Aquagenic Pruritus.	Recruiting	NCT03808805	Phase 3	Aprepitant 80 mg;Hydroxyzine 25mg;Placebo of Hydroxyzine;Placebo of Aprepitant
34	A Phase 3b, Open-label, Single-arm, Rollover Study to Evaluate Long-term Safety in Subjects Who Have Participated in Other Luspatercept (ACE-536) Clinical Trials	Recruiting	NCT04064060	Phase 3	Luspatercept
35	AVAJAK: Apixaban/Rivaroxaban Versus Aspirin for Primary Prevention of Thrombo-embolic Complications in JAK2V617F-positive Myeloproliferative Neoplasms	Recruiting	NCT05198960	Phase 3	Direct Oral Anticoagulants;Low-dose aspirin
36	Haploidentical Allogeneic Peripheral Blood Transplantation: Clinical Trial and Laboratory Correlates Examining Checkpoint Immune Regulators' Expression	Recruiting	NCT03480360	Phase 3	Cyclophosphamide;Fludarabine;Tacrolimus;cellcept;g-csf
37	PRO#1278: A Phase III Study of Fludarabine and Busulfan Versus Fludarabine, Busulfan and Low Dose Total Body Irradiation in Patients Receiving an Allogeneic Hematopoietic Stem Cell Transplant	Active, not recruiting	NCT01366612	Phase 3	Fludarabine and Busulfan plus/minus Total Body Irradiation (low dose);Fludarabine and Busulfan + Low Dose Total Body Irradiation (LD TBI)
38	Tacrolimus, Mini-dose Methotrexate and Mycophenolate Mofetil Versus Tacrolimus and Methotrexate for the Prevention of Acute Graft-versus-Host-Disease	Active, not recruiting	NCT01951885	Phase 3	tacrolimus;methotrexate;Mycophenolate mofetil;Methotrexate (low dose)
39	Risk-Stratified Therapy for Acute Myeloid Leukemia in Down Syndrome	Active, not recruiting	NCT02521493	Phase 3	Asparaginase;Asparaginase Erwinia chrysanthemi;Cytarabine;Daunorubicin Hydrochloride;Etoposide;Mitoxantrone Hydrochloride;Thioguanine
40	The Promoting Resilience in Stress Management (PRISM) Intervention: a Multi-site Randomized Controlled Trial for Adolescents and Young Adults Receiving Hematopoietic Cell Transplantation	Active, not recruiting	NCT03640325	Phase 3
41	An Open-label, Uncontrolled, Multicenter, Multinational Study on the Efficacy and Safety of Administration of Donor Lymphocytes Depleted of Alloreactive T-cells (ATIR), Through the Use of TH9402 and Light Treatment in an ex Vivo Process, in Patients Receiving a CD34-selected Peripheral Blood Stem Cell Graft From a Related, Haploidentical Donor	Terminated	NCT00967343	Phase 2, Phase 3
42	Randomized, Double Blinded, Placebo-Controlled Trial of Antibacterial Prophylaxis for the Prevention of Bacterial Infections in the Post-Engraftment Phase After Allogeneic Hematopoeitic Stem Cell Transplantation	Terminated	NCT00324324	Phase 3	moxifloxacin hydrochloride;Placebo
43	Randomized Study to Compare Post Bone Marrow Transplant Cyclophosphamide With the Combination of Methotrexate Plus Calcineurin Inhibitor for Graft Versus Host Disease Prophylaxis	Terminated	NCT01749111	Phase 3	ARM A Cyclophosphamide;ARM B Calcineurin inhibitor and methotrexate
44	Treatment of Transient Myeloproliferative Disorder (TMD) in Children With Down Syndrome (DS)	Withdrawn	NCT00411281	Phase 3	cytarabine
45	A Multiinstitutional Trial To Evaluate The Prophylactic Use Of NASA-Developed Light Emitting Diodes For The Prevention Of Oral Mucositis In Bone Marrow Transplant Patients	Unknown status	NCT00036712	Phase 2
46	Open Label Pilot Phase II Study of STI571 in the Treatment of Patients With Idiopathic Hypereosinophilic Syndrome (HES) and Eosinophilic Leukemias	Unknown status	NCT00276926	Phase 2	STI571
47	A Phase 1b/2 Study to Evaluate the Safety and Efficacy of APR-246 in Combination With Azacitidine for the Treatment of Mutation TP53 (TP53) Mutant Myeloid Neoplasms	Unknown status	NCT03588078	Phase 1, Phase 2	APR-246;Azacitidine
48	Transplantation Using Umbilical Cord And Placental Blood	Unknown status	NCT00008164	Phase 2
49	Dual Vaccine Trial in Myeloproliferative Neoplasms	Unknown status	NCT04051307	Phase 1, Phase 2	PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL;Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
50	The Efficacy of Velcade on Bone Tissue During Myelomatosis (Bone Marrow Cancer)	Completed	NCT00436059	Phase 2	bortezomib

Search NIH Clinical Center for Bone Marrow Cancer

Inferred drug relations via UMLS ⁷¹ / NDF-RT ⁵⁰ :

Sodium phenylbutyrate

Cochrane evidence based reviews: myeloproliferative disorders

Sources

Genetic Tests for Bone Marrow Cancer

Sources

Anatomical Context for Bone Marrow Cancer

Organs/tissues related to Bone Marrow Cancer:

MalaCards : Bone Marrow, Bone, Myeloid, T Cells, Kidney, Lymph Node, Breast

Sources

Publications for Bone Marrow Cancer

Articles related to Bone Marrow Cancer:

(show top 50) (show all 172)

#	Title	Authors	PMID	Year
1	A systematic review of recent trends in research on therapeutically significant L-asparaginase and acute lymphoblastic leukemia. ⁶²	Suresh SA...Rajnish KN	35816224	2022
2	Changes in Bone Marrow Tumor and Immune Cells Correlate with Durability of Remissions Following BCMA CAR T Therapy in Myeloma. ⁶²	Dhodapkar KM...Dhodapkar MV	36026513	2022
3	Bone Marrow Endothelial Cells Increase Prostate Cancer Cell Apoptosis in 3D Triculture Model of Reactive Stroma. ⁶²	Sablatura LK...Farach-Carson MC	36138750	2022
4	Treatment of chemotherapy-induced thrombocytopenia in patients with non-hematologic malignancies. ⁶²	Kuter DJ	35642485	2022
5	Frailty-adjusted therapy in Transplant Non-Eligible patients with newly diagnosed Multiple Myeloma (FiTNEss (UK-MRA Myeloma XIV Trial)): a study protocol for a randomised phase III trial. ⁶²	Coulson AB...Cook G	35654466	2022
6	Cellular senescence in cancers: relationship between bone marrow cancer and cellular senescence. ⁶²	Sarikhani M...Firouzamandi M	35449316	2022
7	CXCR4 and anti-BCMA CAR co-modified natural killer cells suppress multiple myeloma progression in a xenograft mouse model. ⁶²	Ng YY...Wang S	34471234	2022
8	Enrichment-Free Single-Cell Detection and Morphogenomic Profiling of Myeloma Patient Samples to Delineate Circulating Rare Plasma Cell Clones. ⁶²	Ndacayisaba LJ...Kuhn P	35621632	2022
9	Natural killer cells activity against multiple myeloma cells is modulated by osteoblast-induced IL-6 and IL-10 production. ⁶²	Uhl C...Zilberberg J	35846441	2022
10	ADRB3 induces mobilization and inhibits differentiation of both breast cancer cells and myeloid-derived suppressor cells. ⁶²	Zhou Z...Zheng M	35145073	2022
11	Correlation of Cytokine Release Syndrome With Prognosis After Chimeric Antigen Receptor T Cell Therapy: Analysis of 54 Patients With Relapsed or Refractory Multiple Myeloma. ⁶²	Wang X...Cao J	35572513	2022
12	Vγ9Vδ2 T cells expressing a BCMA-Specific chimeric antigen receptor inhibit multiple myeloma xenograft growth. ⁶²	Zhang X...Wang S	35709135	2022
13	Clinical characteristics of COVID-19-infected cancer patients, Isfahan, Iran. ⁶²	Sharifi M...Javanmard SH	36353349	2022
14	Metabolic Disorders in Multiple Myeloma. ⁶²	Gavriatopoulou M...Dimopoulos MA	34768861	2021
15	Combination Therapy of Navitoclax with Chemotherapeutic Agents in Solid Tumors and Blood Cancer: A Review of Current Evidence. ⁶²	Nor Hisam NS...Mohamad Anuar NN	34575429	2021
16	A multicenter study of romiplostim for chemotherapy-induced thrombocytopenia in solid tumors and hematologic malignancies. ⁶²	Al-Samkari H...Kuter DJ	32499239	2021
17	Association of RANK and RANKL gene polymorphism with survival and calcium levels in multiple myeloma. ⁶²	Lacina P...Bogunia-Kubik K	33283899	2021
18	Withanolide-Type Steroids from Withania aristata as Potential Anti-Leukemic Agents. ⁶²	Moujir LM...Jimenez IA	33291428	2020
19	Antimyeloma Potential of Caffeic Acid Phenethyl Ester and Its Analogues through Sp1 Mediated Downregulation of IKZF1-IRF4-MYC Axis. ⁶²	Murugesan A...Reiman T	33210536	2020
20	Adaptation and Evaluation of a Symptom-Monitoring Digital Health Intervention for Patients With Relapsed and Refractory Multiple Myeloma: Pilot Mixed-Methods Implementation Study. ⁶²	Biran N...Panjabi S	33200997	2020
21	Primary bone lymphoma: pictorial essay. ⁶²	Stefanini FS...Cerqueira WS	33304011	2020
22	Strategic use of patent opposition safeguard to improve equitable access to innovative health technologies: A case study of CAR T-cell therapy Kymriah. ⁶²	Abbas MZ	33031009	2020
23	89Zr-pembrolizumab biodistribution is influenced by PD-1-mediated uptake in lymphoid organs. ⁶²	van der Veen EL...Lub-de Hooge MN	33020241	2020
24	Amides as bioisosteres of triazole-based geranylgeranyl diphosphate synthase inhibitors. ⁶²	Goetz DB...Holstein SA	32690260	2020
25	Proteosomal degradation of NSD2 by BRCA1 promotes leukemia cell differentiation. ⁶²	Park JW...Seo SB	32826945	2020
26	GRASP55 Is Dispensable for Normal Hematopoiesis but Necessary for Myc-Dependent Leukemic Growth. ⁶²	Bailly AL...Aurrand-Lions M	32229537	2020
27	Epigenetic control of the EWS‑FLI1 promoter in Ewing's sarcoma. ⁶²	Montoya C...Rojas A	32323788	2020
28	[Clinical Efficacy and Prognostic Factors of Newly Diagnosed Children[JP] with Burkitt Lymphoma Treated by High-Dose and Short-Course Modified LMB Regimen ± Rituximab]. ⁶²	Wang BT...Wei YJ	32319391	2020
29	Specific Features of Interactions between Megakaryocytic and Granulocytic Hematopoiesis Lineages and Myelofibrosis during the Acute Phase of Chronic Myeloid Leukemia, Chronic Lymphocytic Leukemia, and Multiple Myeloma. ⁶²	Dolgikh TY...Krinitsyna YM	32333309	2020
30	High-risk smoldering myeloma versus early detection of multiple myeloma: Current models, goals of therapy, and clinical implications. ⁶²	Kunacheewa C...Manasanch EE	32139017	2020
31	Proteasome inhibition in multiple myeloma: lessons for other cancers. ⁶²	Saavedra-Garcia P...Auner HW	31875696	2020
32	Leveraging RSF and PET images for prognosis of multiple myeloma at diagnosis. ⁶²	Morvan L...Mateus D	31256359	2020
33	Prolonged Response of a Patient with Relapsed Acute Myeloid Leukemia to a Novel Oral Bromodomain Extraterminal Inhibitor (BETi). ⁶²	Chang Munoz M...Jonas BA	33381331	2020
34	Ligand-Receptor Interactions of Galectin-9 and VISTA Suppress Human T Lymphocyte Cytotoxic Activity. ⁶²	Yasinska IM...Sumbayev VV	33329552	2020
35	Exploration of quinolone and quinoline derivatives as potential anticancer agents. ⁶²	Iqbal J...Langer P	31410781	2019
36	Multi-organ system for the evaluation of efficacy and off-target toxicity of anticancer therapeutics. ⁶²	McAleer CW...Hickman JJ	31217335	2019
37	Methylation and PTEN activation in dental pulp mesenchymal stem cells promotes osteogenesis and reduces oncogenesis. ⁶²	Shen WC...Hung SC	31110221	2019
38	Single-cell imaging of CAR T cell activity in vivo reveals extensive functional and anatomical heterogeneity. ⁶²	Cazaux M...Bousso P	30936262	2019
39	[Consistency Analysis of Gene Mutation Sites of Bone Marrow Tumor DNA and Circulating Tumor DNA in Patients with Myelodysplastic Syndrome]. ⁶²	Zhao P...Hu XM	30738462	2019
40	Liposomal dexamethasone inhibits tumor growth in an advanced human-mouse hybrid model of multiple myeloma. ⁶²	Deshantri AK...Schiffelers RM	30682443	2019
41	Persistent Exposure to Fusobacterium nucleatum Triggers Chemokine/Cytokine Release and Inhibits the Proliferation and Osteogenic Differentiation Capabilities of Human Gingiva-Derived Mesenchymal Stem Cells. ⁶²	Kang W...Feng Q	31921705	2019
42	Health-related quality of life in acute myeloid leukemia patients not eligible for intensive chemotherapy: results of a systematic literature review. ⁶²	Forsythe A...Arondekar B	30679915	2019
43	Dural Cells Release Factors Which Promote Cancer Cell Malignancy and Induce Immunosuppressive Markers in Bone Marrow Myeloid Cells. ⁶²	Szerlip NJ...Clines GA	29462368	2018
44	Biochemical mechanisms implemented by human acute myeloid leukemia cells to suppress host immune surveillance. ⁶²	Yasinska IM...Sumbayev VV	29872115	2018
45	Distinctive inhibition of alkaline phosphatase isozymes by thiazol-2-ylidene-benzamide derivatives: Functional insights into their anticancer role. ⁶²	Ejaz SA...Iqbal J	29363794	2018
46	Detailed investigation of anticancer activity of sulfamoyl benz(sulfon)amides and 1H-pyrazol-4-yl benzamides: An experimental and computational study. ⁶²	Iqbal J...Al-Rashida M	29763580	2018
47	The Lipid Side of Bone Marrow Adipocytes: How Tumor Cells Adapt and Survive in Bone. ⁶²	Diedrich JD...Podgorski I	29869753	2018
48	Immune cell contexture in the bone marrow tumor microenvironment impacts therapy response in CML. ⁶²	Bruck O...Mustjoki S	29925907	2018
49	[Clinical features and prognosis of children with mature B-cell non-Hodgkin's lymphoma: an analysis of 28 cases]. ⁶²	Chen ZS...Shen JZ	29972121	2018
50	Mesenchymal Stromal Cells: Emerging Roles in Bone Metastasis. ⁶²	Graham N...Qian BZ	29642534	2018

Sources

Genes for Bone Marrow Cancer

Genes related to Bone Marrow Cancer (0 elite genes):

(show top 50) (show all 86)

- Elite gene

- Cancer Census gene in COSMIC

#	Symbol	Description	Category	Score	Evidence
1	U2AF1	U2 Small Nuclear RNA Auxiliary Factor 1	Protein Coding	16.32	DISEASES inferred ¹⁴ ¹⁴
2	H2AC18	H2A Clustered Histone 18	Protein Coding	12.03	DISEASES inferred ¹⁴ ¹⁴
3	LUC7L2	LUC7 Like 2, Pre-MRNA Splicing Factor	Protein Coding	11.29	DISEASES inferred ¹⁴ ¹⁴
4	MIR21	MicroRNA 21	RNA Gene	10.53	DISEASES inferred ¹⁴ ¹⁴
5	CCR6	C-C Motif Chemokine Receptor 6	Protein Coding	10.43	DISEASES inferred ¹⁴ ¹⁴
6	ICOSLG	Inducible T Cell Costimulator Ligand	Protein Coding	10.24	DISEASES inferred ¹⁴ ¹⁴
7	KDM4C	Lysine Demethylase 4C	Protein Coding	10.11	DISEASES inferred ¹⁴ ¹⁴
8	MIR17	MicroRNA 17	RNA Gene	10.08	DISEASES inferred ¹⁴ ¹⁴
9	MIR125A	MicroRNA 125a	RNA Gene	9.68	DISEASES inferred ¹⁴ ¹⁴
10	MIR126	MicroRNA 126	RNA Gene	9.68	DISEASES inferred ¹⁴ ¹⁴
11	MIR145	MicroRNA 145	RNA Gene	9.58	DISEASES inferred ¹⁴ ¹⁴
12	JAK2	Janus Kinase 2	Protein Coding	9.5	DISEASES inferred ¹⁴
13	MIR155	MicroRNA 155	RNA Gene	9.36	DISEASES inferred ¹⁴ ¹⁴
14	MIR140	MicroRNA 140	RNA Gene	9.25	DISEASES inferred ¹⁴ ¹⁴
15	MIR199A1	MicroRNA 199a-1	RNA Gene	9.22	DISEASES inferred ¹⁴ ¹⁴
16	MIR142	MicroRNA 142	RNA Gene	9.2	DISEASES inferred ¹⁴ ¹⁴
17	MIR34A	MicroRNA 34a	RNA Gene	9.18	DISEASES inferred ¹⁴ ¹⁴
18	MIR221	MicroRNA 221	RNA Gene	9.13	DISEASES inferred ¹⁴ ¹⁴
19	MIR9-1	MicroRNA 9-1	RNA Gene	9.07	DISEASES inferred ¹⁴ ¹⁴
20	MIR181A1	MicroRNA 181a-1	RNA Gene	9.07	DISEASES inferred ¹⁴ ¹⁴
21	MIR27A	MicroRNA 27a	RNA Gene	9.05	DISEASES inferred ¹⁴ ¹⁴
22	SDC1	Syndecan 1	Protein Coding	8.97	DISEASES inferred ¹⁴
23	CD34	CD34 Molecule	Protein Coding	8.94	DISEASES inferred ¹⁴
24	CD38	CD38 Molecule	Protein Coding	8.93	DISEASES inferred ¹⁴
25	ASXL1	ASXL Transcriptional Regulator 1	Protein Coding	8.78	DISEASES inferred ¹⁴
26	MIR30A	MicroRNA 30a	RNA Gene	8.73	DISEASES inferred ¹⁴ ¹⁴
27	TET2	Tet Methylcytosine Dioxygenase 2	Protein Coding	8.68	DISEASES inferred ¹⁴
28	MIR150	MicroRNA 150	RNA Gene	8.64	DISEASES inferred ¹⁴ ¹⁴
29	MIR196A1	MicroRNA 196a-1	RNA Gene	8.62	DISEASES inferred ¹⁴ ¹⁴
30	MYOM2	Myomesin 2	Protein Coding	8.62	DISEASES inferred ¹⁴
31	TP53	Tumor Protein P53	Protein Coding	8.56	DISEASES inferred ¹⁴
32	MIR19A	MicroRNA 19a	RNA Gene	8.5	DISEASES inferred ¹⁴ ¹⁴
33	FLT3	Fms Related Receptor Tyrosine Kinase 3	Protein Coding	8.47	DISEASES inferred ¹⁴
34	CALR	Calreticulin	Protein Coding	8.47	DISEASES inferred ¹⁴
35	MIR214	MicroRNA 214	RNA Gene	8.41	DISEASES inferred ¹⁴ ¹⁴
36	CSF3	Colony Stimulating Factor 3	Protein Coding	8.41	DISEASES inferred ¹⁴
37	IL6	Interleukin 6	Protein Coding	8.39	DISEASES inferred ¹⁴
38	CD19	CD19 Molecule	Protein Coding	8.39	DISEASES inferred ¹⁴
39	ABL1	ABL Proto-Oncogene 1, Non-Receptor Tyrosine Kinase	Protein Coding	8.34	DISEASES inferred ¹⁴
40	SRSF2	Serine And Arginine Rich Splicing Factor 2	Protein Coding	8.31	DISEASES inferred ¹⁴
41	IGHV4-38-2	Immunoglobulin Heavy Variable 4-38-2	Protein Coding	8.28	DISEASES inferred ¹⁴
42	B2M	Beta-2-Microglobulin	Protein Coding	8.27	DISEASES inferred ¹⁴
43	MYC	MYC Proto-Oncogene, BHLH Transcription Factor	Protein Coding	8.25	DISEASES inferred ¹⁴
44	DNMT3A	DNA Methyltransferase 3 Alpha	Protein Coding	8.24	DISEASES inferred ¹⁴
45	BCL2	BCL2 Apoptosis Regulator	Protein Coding	8.22	DISEASES inferred ¹⁴
46	JAK1	Janus Kinase 1	Protein Coding	8.17	DISEASES inferred ¹⁴
47	MIR122	MicroRNA 122	RNA Gene	8.15	DISEASES inferred ¹⁴ ¹⁴
48	U2AF1L4	U2 Small Nuclear RNA Auxiliary Factor 1 Like 4	Protein Coding	8.13	DISEASES inferred ¹⁴
49	AKT1	AKT Serine/Threonine Kinase 1	Protein Coding	8.13	DISEASES inferred ¹⁴
50	CD8A	CD8a Molecule	Protein Coding	8.12	DISEASES inferred ¹⁴

Sources

Variations for Bone Marrow Cancer

Sources

Expression for Bone Marrow Cancer

Search GEO for disease gene expression data for Bone Marrow Cancer.

Sources

Pathways for Bone Marrow Cancer

Pathways related to Bone Marrow Cancer according to GeneCards Suite gene sharing:

#	Super pathways	Score	Top Affiliating Genes
1	miRNAs involved in DNA damage response ⁷⁴	11.38	MIR221 MIR21 MIR181A1 MIR17 MIR145
2	miRNAs involvement in the immune response in sepsis ⁷⁴	11.23	MIR9-1 MIR21 MIR199A1 MIR155 MIR145 MIR126
3	Cell differentiation - expanded index ⁷⁴ Show member pathways Cell differentiation - index ⁷⁴	11.06	MIR9-1 MIR221 MIR199A1 MIR181A1 MIR17 MIR155

Sources

GO Terms for Bone Marrow Cancer

Cellular components related to Bone Marrow Cancer according to GeneCards Suite gene sharing:

#	Name	GO ID	Score	Top Affiliating Genes
1	RISC complex	GO:0016442	9.7	MIR9-1 MIR221 MIR21 MIR199A1 MIR181A1 MIR17
2	extracellular vesicle	GO:1903561	9.43	MIR34A MIR221 MIR21 MIR17 MIR126 MIR125A

Biological processes related to Bone Marrow Cancer according to GeneCards Suite gene sharing:

(show all 24)

#	Name	GO ID	Score	Top Affiliating Genes
1	cellular response to hypoxia	GO:0071456	9.89	MIR34A MIR17 MIR140 MIR126
2	positive regulation of protein kinase B signaling	GO:0051897	9.88	MIR221 MIR21 MIR199A1 MIR126
3	negative regulation of angiogenesis	GO:0016525	9.86	MIR34A MIR21 MIR145 MIR125A
4	negative regulation of gene expression	GO:0010629	9.86	MIR9-1 MIR34A MIR21 MIR199A1 MIR17 MIR155
5	negative regulation of cell migration	GO:0030336	9.85	MIR9-1 MIR34A MIR21 MIR145 MIR126
6	negative regulation of inflammatory response	GO:0050728	9.8	MIR221 MIR199A1 MIR145 MIR142 MIR126
7	negative regulation of osteoblast differentiation	GO:0045668	9.79	MIR9-1 MIR17 MIR140
8	positive regulation of vascular associated smooth muscle cell proliferation	GO:1904707	9.77	JAK2 MIR17 MIR21 MIR221
9	negative regulation of cytokine production involved in inflammatory response	GO:1900016	9.72	MIR125A MIR140 MIR221
10	negative regulation of cardiac muscle cell apoptotic process	GO:0010667	9.72	MIR21 MIR199A1 MIR145 JAK2
11	miRNA-mediated gene silencing	GO:0035195	9.68	MIR9-1 MIR34A MIR221 MIR21 MIR199A1 MIR181A1
12	negative regulation of sprouting angiogenesis	GO:1903671	9.67	MIR34A MIR221 MIR17
13	negative regulation of vascular associated smooth muscle cell migration	GO:1904753	9.65	MIR34A MIR21 MIR140
14	miRNA-mediated gene silencing by inhibition of translation	GO:0035278	9.63	MIR9-1 MIR221 MIR21 MIR17 MIR145 MIR126
15	positive regulation of connective tissue replacement	GO:1905205	9.61	MIR34A MIR199A1
16	positive regulation of cardiac muscle hypertrophy in response to stress	GO:1903244	9.61	MIR199A1 MIR17
17	negative regulation of vascular associated smooth muscle cell apoptotic process	GO:1905460	9.6	MIR21 MIR17
18	positive regulation of metalloendopeptidase activity	GO:1904685	9.58	MIR21 MIR17
19	negative regulation of leukocyte adhesion to vascular endothelial cell	GO:1904995	9.57	MIR221 MIR125A
20	negative regulation of BMP secretion	GO:2001285	9.54	MIR17 MIR140
21	negative regulation of interleukin-21 production	GO:0032705	9.52	MIR221 MIR21
22	positive regulation of cellular response to hypoxia	GO:1900039	9.51	MIR21 MIR145
23	negative regulation of interleukin-16 production	GO:0032699	9.43	MIR145 MIR125A
24	negative regulation of vascular endothelial growth factor production	GO:1904046	9.35	MIR125A MIR140 MIR17 MIR199A1 MIR34A

Molecular functions related to Bone Marrow Cancer according to GeneCards Suite gene sharing:

#	Name	GO ID	Score	Top Affiliating Genes
1	mRNA 3'-UTR binding	GO:0003730	9.7	MIR9-1 MIR34A MIR21 MIR199A1 MIR17 MIR155
2	mRNA base-pairing translational repressor activity	GO:1903231	9.4	MIR9-1 MIR34A MIR221 MIR21 MIR199A1 MIR17