MPD
MCID: MYL031
MIFTS: 65

Myeloproliferative Neoplasm (MPD)

Categories: Blood diseases, Bone diseases, Cancer diseases, Immune diseases, Rare diseases
Data Licensing
For inquiries, contact:

Aliases & Classifications for Myeloproliferative Neoplasm

MalaCards integrated aliases for Myeloproliferative Neoplasm:

Name: Myeloproliferative Neoplasm 11 58 28 53 5 14 36 75
Myeloproliferative Disorder 58 28 5 38 16
Chronic Myeloproliferative Disease 11 53 31
Chronic Myeloproliferative Disorder 16 71
Myeloproliferative Neoplasms 14 33
Chronic Myeloproliferative Disorders 19
Myeloproliferative Disorders 53
Myeloproliferative Disease 71
Campomelic Dysplasia 71
Cmpd, U 11
Cmpd 11
Mpd 58
Mpn 58

Characteristics:


Prevelance:

1-9/100000 (Europe) 58

Age Of Onset:

All ages 58

Classifications:

Orphanet: 58  
Rare haematological diseases


External Ids:

Disease Ontology 11 DOID:2226
NCIt 49 C4345
SNOMED-CT 68 115248004
ICD10 31 D47.1
MESH via Orphanet 44 D009196
UMLS via Orphanet 72 C0027022 C1292778
Orphanet 58 ORPHA98274
ICD11 33 37207998
UMLS 71 C0027022 C1292778 C1861922

Summaries for Myeloproliferative Neoplasm

GARD: 19 Chronic myeloproliferative disorders are a group of slow-growing blood cancers in which the bone marrow makes too many abnormal red blood cells, white blood cells, or platelets, which accumulate in the blood. The type of myeloproliferative disorder is based on whether too many red blood cells, white blood cells, or platelets are being made. Sometimes the body will make too many of more than one type of blood cell, but usually one type of blood cell is affected more than the others. There are 6 types of Chronic myeloproliferative disorders: chronic myelogenous leukemia (CML), polycythemia vera, primary myelofibrosis (also called chronic idiopathic myelofibrosis), essential thrombocythemia, chronic neutrophilic leukemia, and chronic eosinophilic leukemia.

MalaCards based summary: Myeloproliferative Neoplasm, also known as myeloproliferative disorder, is related to myelodysplastic/myeloproliferative neoplasm and myeloproliferative disorder, chronic, with eosinophilia, and has symptoms including apnea and respiratory distress. An important gene associated with Myeloproliferative Neoplasm is JAK2 (Janus Kinase 2), and among its related pathways/superpathways are ERK Signaling and Disease. The drugs Idarubicin and Thalidomide have been mentioned in the context of this disorder. Affiliated tissues include bone marrow, myeloid and bone, and related phenotypes are Decreased viability and Decreased substrate adherent cell growth

Disease Ontology: 11 A myeloid neoplasm that is characterized by a group of slow growing blood cancers in which large numbers of abnormal red blood cells, white blood cells, or platelets grow and spread in the bone marrow and the peripheral blood.

Wikipedia: 75 Myeloproliferative neoplasms (MPNs) are a group of rare blood cancers in which excess red blood cells,... more...

Related Diseases for Myeloproliferative Neoplasm

Diseases related to Myeloproliferative Neoplasm via text searches within MalaCards or GeneCards Suite gene sharing:

(show top 50) (show all 696)
# Related Disease Score Top Affiliating Genes
1 myelodysplastic/myeloproliferative neoplasm 33.2 STAT5A PDGFRB PDGFRA KIT JAK2 FLT3
2 myeloproliferative disorder, chronic, with eosinophilia 32.8 PDGFRB ETV6
3 essential thrombocythemia 32.8 THPO STAT5A MPL KIT JAK3 JAK2
4 atypical chronic myeloid leukemia, bcr-abl1 negative 32.6 PDGFRB PDGFRA JAK2 FLT3 ETV6 ABL1
5 juvenile myelomonocytic leukemia 32.6 STAT5A PDGFRB PDGFRA KIT JAK3 JAK2
6 myelofibrosis 32.6 THPO STAT5A PDGFRB MPL KIT JAK3
7 polycythemia vera 32.6 THPO STAT5A PDGFRB PDGFRA MPL KIT
8 chronic myelomonocytic leukemia 32.5 STAT5A PDGFRB PDGFRA MPL KIT JAK2
9 myeloproliferative syndrome, transient 32.3 THPO MPL KIT GATA1 FLT3
10 chronic eosinophilic leukemia 32.3 STAT5A PDGFRB PDGFRA MPL KIT JAK2
11 leukemia, chronic myeloid 32.2 THPO STAT5A PDGFRB PDGFRA MPL MIR155
12 thrombocythemia 3 32.2 JAK2 INSL6
13 polycythemia 32.0 THPO STAT5A MPL JAK2 INSL6 GATA1
14 thrombocythemia 1 31.9 THPO MPL
15 thrombocytosis 31.9 THPO MPL JAK2
16 splenomegaly 31.8 MPL JAK2 INSL6
17 myelodysplastic syndrome 31.6 THPO STAT5A PDGFRB PDGFRA MPL KIT
18 myeloid leukemia 31.6 PDGFRB PDGFRA KIT JAK2 FLT3 ETV6
19 hypereosinophilic syndrome 31.5 ZBTB20 PDGFRB PDGFRA KIT JAK2 ABL1
20 leukemia, acute myeloid 31.4 THPO STAT5A PDGFRB PDGFRA MPL MIR155
21 leukemia 31.3 THPO PDGFRB MPL KIT JAK2 FLT3
22 pancytopenia 31.2 THPO MPL KIT FLT3
23 acquired polycythemia 31.2 MPL JAK2 ABL1
24 portal vein thrombosis 31.2 THPO MPL JAK2
25 systemic mastocytosis 31.1 STAT5A PDGFRB PDGFRA KIT JAK2
26 hematologic cancer 31.1 THPO STAT5A PDGFRB MPL MIR155 KIT
27 mastocytosis 31.0 STAT5A PDGFRB PDGFRA KIT JAK2 FLT3
28 myeloid and lymphoid neoplasms associated with pdgfra rearrangement 31.0 PDGFRB PDGFRA KIT JAK2 ETV6 ABL1
29 acute leukemia 31.0 THPO STAT5A MPL KIT JAK2 GATA1
30 neutropenia 31.0 THPO STAT5A MPL JAK2 FLT3
31 acute myelomonocytic leukemia 30.9 KIT FLT3 ETV6 CSF1R
32 acute promyelocytic leukemia 30.9 KIT GATA1 FLT3 ETV6 DNMT3A CSF1R
33 leukemia, chronic lymphocytic 30.9 THPO STAT5A MIR155 KIT JAK2 FLT3
34 deficiency anemia 30.9 THPO MPL KIT JAK2 GATA1 FLT3
35 budd-chiari syndrome 30.9 PDGFRA MPL JAK2 INSL6
36 bone marrow cancer 30.9 THPO MPL MIR155 KIT JAK2 FLT3
37 erythrocytosis, familial, 1 30.9 STAT5A JAK2 INSL6
38 blood platelet disease 30.9 THPO MPL KIT JAK2 GATA1 FLT3
39 leukemia, acute lymphoblastic 30.9 THPO MPL MIR155 KIT JAK3 JAK2
40 down syndrome 30.8 MIR155 JAK3 JAK2 GATA1 FLT3 FGFR3
41 precursor t-cell acute lymphoblastic leukemia 30.7 FLT3 ETV6 ABL1
42 hypereosinophilic syndrome, idiopathic 30.7 PDGFRB PDGFRA KIT
43 thrombocytopenia 30.6 THPO PDGFRA MPL MIR155 KIT JAK2
44 stress polycythemia 30.6 PDGFRA JAK2 ABL1
45 primary hypereosinophilic syndrome 30.6 PDGFRB PDGFRA ETV6
46 myelophthisic anemia 30.6 MPL JAK2 ABL1
47 myeloid and lymphoid neoplasms with eosinophilia and abnormalities of pdgfra, pdgfrb, and fgfr1 30.6 PDGFRB PDGFRA
48 aplastic anemia 30.6 THPO MPL GATA1 FLT3
49 angiosarcoma 30.5 PDGFRB PDGFRA KIT ABL1
50 b-lymphoblastic leukemia/lymphoma 30.5 KIT FLT3 ETV6 ABL1

Graphical network of the top 20 diseases related to Myeloproliferative Neoplasm:



Diseases related to Myeloproliferative Neoplasm

Symptoms & Phenotypes for Myeloproliferative Neoplasm

UMLS symptoms related to Myeloproliferative Neoplasm:


apnea; respiratory distress

GenomeRNAi Phenotypes related to Myeloproliferative Neoplasm according to GeneCards Suite gene sharing:

25 (show top 50) (show all 53)
# Description GenomeRNAi Source Accession Score Top Affiliating Genes
1 Decreased viability GR00055-A-3 10.84 CSF1R
2 Decreased viability GR00173-A 10.84 PDGFRA FLT3
3 Decreased viability GR00221-A-1 10.84 ABL1 FGFR3 PDGFRA PDGFRB CSF1R FLT3
4 Decreased viability GR00221-A-2 10.84 ABL1 FGFR3
5 Decreased viability GR00221-A-3 10.84 ABL1 FGFR3 JAK3 PDGFRA PDGFRB
6 Decreased viability GR00221-A-4 10.84 PDGFRA PDGFRB CSF1R FLT3
7 Decreased viability GR00249-S 10.84 FGFR3 PDGFRA
8 Decreased viability GR00301-A 10.84 KIT
9 Decreased viability GR00342-S-1 10.84 ABL1 PDGFRB
10 Decreased viability GR00342-S-2 10.84 ABL1
11 Decreased viability GR00342-S-3 10.84 ABL1
12 Decreased viability GR00402-S-2 10.84 JAK3 PDGFRA CSF1R
13 Decreased substrate adherent cell growth GR00193-A-1 10.25 KIT
14 Decreased substrate adherent cell growth GR00193-A-2 10.25 ABL1 KIT CSF1R JAK2
15 Decreased substrate adherent cell growth GR00193-A-3 10.25 JAK2
16 Decreased substrate adherent cell growth GR00193-A-4 10.25 ABL1 FLT3 KIT
17 Increased shRNA abundance (Z-score > 2) GR00366-A-10 10.25 FGFR3
18 Increased shRNA abundance (Z-score > 2) GR00366-A-11 10.25 JAK3
19 Increased shRNA abundance (Z-score > 2) GR00366-A-114 10.25 FGFR3
20 Increased shRNA abundance (Z-score > 2) GR00366-A-116 10.25 STAT5A
21 Increased shRNA abundance (Z-score > 2) GR00366-A-121 10.25 FGFR3
22 Increased shRNA abundance (Z-score > 2) GR00366-A-134 10.25 STAT5A
23 Increased shRNA abundance (Z-score > 2) GR00366-A-142 10.25 STAT5A
24 Increased shRNA abundance (Z-score > 2) GR00366-A-143 10.25 STAT5A
25 Increased shRNA abundance (Z-score > 2) GR00366-A-149 10.25 JAK3
26 Increased shRNA abundance (Z-score > 2) GR00366-A-151 10.25 ABL1
27 Increased shRNA abundance (Z-score > 2) GR00366-A-152 10.25 KIT
28 Increased shRNA abundance (Z-score > 2) GR00366-A-157 10.25 ABL1 KIT
29 Increased shRNA abundance (Z-score > 2) GR00366-A-170 10.25 KIT
30 Increased shRNA abundance (Z-score > 2) GR00366-A-190 10.25 STAT5A
31 Increased shRNA abundance (Z-score > 2) GR00366-A-20 10.25 JAK3
32 Increased shRNA abundance (Z-score > 2) GR00366-A-213 10.25 ABL1
33 Increased shRNA abundance (Z-score > 2) GR00366-A-30 10.25 ABL1 KIT
34 Increased shRNA abundance (Z-score > 2) GR00366-A-34 10.25 ABL1
35 Increased shRNA abundance (Z-score > 2) GR00366-A-42 10.25 STAT5A
36 Increased shRNA abundance (Z-score > 2) GR00366-A-43 10.25 ABL1
37 Increased shRNA abundance (Z-score > 2) GR00366-A-47 10.25 ABL1
38 Increased shRNA abundance (Z-score > 2) GR00366-A-52 10.25 FGFR3
39 Increased shRNA abundance (Z-score > 2) GR00366-A-59 10.25 FGFR3
40 Increased shRNA abundance (Z-score > 2) GR00366-A-60 10.25 FGFR3 JAK3
41 Increased shRNA abundance (Z-score > 2) GR00366-A-61 10.25 KIT
42 Increased shRNA abundance (Z-score > 2) GR00366-A-63 10.25 FGFR3
43 Increased shRNA abundance (Z-score > 2) GR00366-A-73 10.25 STAT5A
44 Increased shRNA abundance (Z-score > 2) GR00366-A-85 10.25 ABL1 FGFR3 JAK3 KIT STAT5A
45 Increased shRNA abundance (Z-score > 2) GR00366-A-9 10.25 KIT
46 Increased shRNA abundance (Z-score > 2) GR00366-A-95 10.25 STAT5A
47 Increased shRNA abundance (Z-score > 2) GR00366-A-96 10.25 JAK3
48 Increased shRNA abundance (Z-score > 2) GR00366-A-99 10.25 KIT
49 Decreased viability in pancreas lineage GR00235-A 9.56 DNMT3A FLT3 GATA1 PDGFRB
50 Increased cell viability after pRB stimulation GR00230-A-1 9.54 ABL1 CSF1R KIT

MGI Mouse Phenotypes related to Myeloproliferative Neoplasm:

45 (show all 15)
# Description MGI Source Accession Score Top Affiliating Genes
1 growth/size/body region MP:0005378 10.41 ABL1 CEP85L CSF1R DNMT3A ETV6 FGFR3
2 homeostasis/metabolism MP:0005376 10.4 ABL1 CSF1R DNMT3A ETV6 FGFR3 FLT3
3 cellular MP:0005384 10.33 ABL1 CSF1R DNMT3A ETV6 FGFR3 FLT3
4 nervous system MP:0003631 10.31 ABL1 CEP85L CSF1R DNMT3A FGFR3 JAK2
5 immune system MP:0005387 10.3 ABL1 CEP85L CSF1R ETV6 FGFR3 FLT3
6 normal MP:0002873 10.29 ABL1 CSF1R ETV6 FGFR3 GATA1 JAK2
7 endocrine/exocrine gland MP:0005379 10.27 ABL1 CSF1R DNMT3A ETV6 FLT3 INSL6
8 embryo MP:0005380 10.18 ABL1 DNMT3A ETV6 GATA1 JAK2 JAK3
9 hematopoietic system MP:0005397 10.09 ABL1 CSF1R DNMT3A ETV6 FGFR3 FLT3
10 digestive/alimentary MP:0005381 10.06 ABL1 ETV6 FGFR3 JAK3 KIT MIR155
11 skeleton MP:0005390 10.03 ABL1 CSF1R DNMT3A ETV6 FGFR3 FLT3
12 craniofacial MP:0005382 9.98 ABL1 CSF1R FGFR3 KIT PDGFRA PDGFRB
13 respiratory system MP:0005388 9.92 ABL1 FGFR3 GATA1 JAK2 KIT MIR155
14 mortality/aging MP:0010768 9.83 ABL1 CSF1R DNMT3A ETV6 FGFR3 FLT3
15 integument MP:0010771 9.36 CEP85L CSF1R ETV6 FGFR3 GATA1 JAK2

Drugs & Therapeutics for Myeloproliferative Neoplasm

Drugs for Myeloproliferative Neoplasm (from DrugBank, HMDB, Dgidb, PharmGKB, IUPHAR, NovoSeek, BitterDB):

(show top 50) (show all 435)
# Name Status Phase Clinical Trials Cas Number PubChem Id
1
Idarubicin Approved Phase 3 58957-92-9 42890
2
Thalidomide Approved, Investigational, Withdrawn Phase 3 50-35-1 5426
3
Cathine Approved, Experimental, Illicit, Vet_approved, Withdrawn Phase 3 14838-15-4, 492-39-7 131954576 4786 26934
4
Guaifenesin Approved, Investigational, Vet_approved Phase 3 93-14-1 3516
5
Thiotepa Approved, Investigational Phase 2, Phase 3 52-24-4 5453
6
Reviparin Approved, Investigational Phase 3 9041-08-1
7
Hydrocortisone succinate Approved Phase 3 2203-97-6 3643
8
Hydrocortisone acetate Approved, Vet_approved Phase 3 50-03-3
9
Hydrocortisone Approved, Vet_approved Phase 3 50-23-7 3640 5754
10
Amitriptyline Approved Phase 3 50-48-6 2160
11
Baclofen Approved Phase 3 1134-47-0 2284
12
Ketamine Approved, Vet_approved Phase 3 6740-88-1, 1867-66-9 3821
13
Morphine Approved, Investigational Phase 3 57-27-2 5288826
14
Amphotericin B Approved, Investigational Phase 3 1397-89-3 5280965
15
Nystatin Approved, Vet_approved Phase 3 1400-61-9 11953884
16
Deoxycholic acid Approved Phase 3 83-44-3 222528
17
Dextromethorphan Approved Phase 3 125-71-3 5362449 5360696
18
Luspatercept Approved, Investigational Phase 3 1373715-00-4
19
Apixaban Approved Phase 3 503612-47-3 10182969
20
Acetylsalicylic acid Approved, Vet_approved Phase 3 50-78-2 2244
21
Rivaroxaban Approved Phase 3 366789-02-8 9875401
22
Hydroxyzine Approved Phase 3 68-88-2 3658
23
Histamine Approved, Investigational Phase 3 51-45-6 774
24
Daunorubicin Approved Phase 3 20830-81-3 30323
25
Triamcinolone Approved, Vet_approved Phase 3 124-94-7 31307
26
Picropodophyllin Approved, Investigational Phase 3 518-28-5, 477-47-4 10607 72435
27
Vidarabine Approved, Investigational Phase 3 24356-66-9 21704
28
Mitoxantrone Approved, Investigational Phase 3 70476-82-3, 65271-80-9 4212
29
Asparaginase Escherichia coli Approved, Investigational Phase 3 9015-68-3
30
Mercaptopurine Approved Phase 3 50-44-2 667490
31
Tioguanine Approved Phase 3 154-42-7 2723601
32
Levoleucovorin Approved, Experimental, Investigational Phase 3 68538-85-2, 58-05-9, 73951-54-9 149436 6006
33
Methotrexate Approved Phase 3 1959-05-2, 59-05-2 4112 126941
34
Tacrolimus Approved, Investigational Phase 3 104987-11-3 6473866 445643
35
Cyclophosphamide Approved, Investigational Phase 3 50-18-0, 6055-19-2 2907
36
Estradiol Approved, Investigational, Vet_approved Phase 3 50-28-2 5757
37
Ethinylestradiol Approved Phase 3 57-63-6 5991
38
Polyestradiol phosphate Approved Phase 3 28014-46-2
39
Norgestimate Approved, Investigational Phase 3 35189-28-7 6540478
40
Moxifloxacin Approved, Investigational Phase 3 186826-86-8, 354812-41-2, 151096-09-2 152946
41
St. John's Wort Approved, Investigational, Nutraceutical Phase 3 84082-80-4
42
Aspartic acid Approved, Nutraceutical Phase 3 56-84-8 5960
43
Asparagine Approved, Investigational, Nutraceutical Phase 3 70-47-3 6267
44
Folic acid Approved, Nutraceutical, Vet_approved Phase 3 59-30-3 6037
45 Analgesics Phase 3
46 Janus Kinase Inhibitors Phase 3
47 Anticoagulants Phase 3
48 Fibrinolytic Agents Phase 3
49
Epoetin Alfa Phase 3
50 Antidepressive Agents Phase 3

Interventional clinical trials:

(show top 50) (show all 552)
# Name Status NCT ID Phase Drugs
1 Busulfan Dose Escalation Study Based on AUC in the Setting of Busulfan/Fludarabine Conditioning Prior to Allogeneic Hematopoietic Cell Transplantation (HCT) Completed NCT00361140 Phase 4 Busulfan;Fludarabine
2 Intravenous Low-Dose Decitabine Versus Supportive Care in Elderly Patients With Primary Myelodysplastic Syndrome (MDS) (>10% Blasts or High-Risk Cytogenetics), Secondary MDS or Chronic Myelomonocytic Leukemia (CMML) Who Are Not Eligible for Intensive Therapy: An EORTC-German MDS Study Group Randomized Phase III Study Unknown status NCT00043134 Phase 3 decitabine
3 Prospective Study of the Diagnosis and Treatment of Myelodysplastic Syndromes (MDS) in Childhood Unknown status NCT00047268 Phase 3 cytarabine;mercaptopurine
4 Evaluation of Plasmatic Levels of Busulfan in Patients Undergoing Hematopoietic Stem Cell Transplantation Unknown status NCT01800643 Phase 2, Phase 3
5 A Phase-3, Multi-Center, Randomized, Double-Blind, Placebo-Controlled, Parallel-Group Study to Compare Efficacy and Safety of Pomalidomide in Subjects With Myeloproliferative Neoplasm-Associated Myelofibrosis and Red Blood Cell-Transfusion-Dependence Completed NCT01178281 Phase 3 Pomalidomide 0.5 mg;Placebo;Pomalidomide
6 INSPIRE: An Internet-based RCT for Long-term Survivors of Hematopoietic Stem Cell Transplantation Completed NCT00799461 Phase 3
7 A Multi-center Phase III Study Comparing Nonmyeloablative Conditioning With TBI Versus Fludarabine/TBI for HLA-matched Related Hematopoietic Cell Transplantation for Treatment of Hematologic Malignancies Completed NCT00075478 Phase 3 Fludarabine Phosphate;Mycophenolate Mofetil;Cyclosporine
8 A Multi-center Phase III Study Comparing Myeloablative to Nonmyeloablative Transplant Conditioning in Patients With Myelodysplastic Syndrome or Acute Myelogenous Leukemia Completed NCT00322101 Phase 3 cyclophosphamide;mycophenolate mofetil;busulfan;cyclosporine;fludarabine phosphate;tacrolimus;methotrexate
9 A Randomized Phase III Study to Determine the Most Promising Postgrafting Immunosuppression for Prevention of Acute GVHD After Unrelated Donor Hematopoietic Cell Transplantation Using Nonmyeloablative Conditioning for Patients With Hematologic Malignancies: A Multi-center Trial Completed NCT01231412 Phase 3 Cyclosporine;Fludarabine Phosphate;Mycophenolate Mofetil;Sirolimus
10 A Randomized Double Blinded Trial of Topical Caphosol to Prevent Oral Mucositis in Children Undergoing Hematopoietic Stem Cell Transplantation Completed NCT01305200 Phase 3 supersaturated calcium phosphate rinse
11 Treatment of Children With Down Syndrome (DS) and Acute Myeloid Leukemia (AML), Myelodysplastic Syndrome (MDS), and Transient Myeloproliferative Disorder (TMD): A Phase III Group-Wide Study Completed NCT00003593 Phase 3 asparaginase;cytarabine;daunorubicin hydrochloride;methotrexate;therapeutic hydrocortisone;thioguanine
12 Phase III Randomized Trial of an Opioid Titration Order Sheet Compared to Standard of Care in Patients With Cancer Related Pain. Completed NCT00666211 Phase 3
13 Preparatory Aid to Improve Decision Making About Cancer Clinical Trials (PRE-ACT) Completed NCT00750009 Phase 3
14 The Use of American Ginseng (Panax Quinquefolius) to Improve Cancer-Related Fatigue: A Randomized, Double-Blind, Placebo-Controlled Phase III Study Completed NCT00719563 Phase 3 American ginseng
15 The Use of Topical Baclofen, Amitriptyline HCI, and Ketamine (BAK) in a PLO Gel vs. Placebo for the Treatment of Chemotherapy Induced Peripheral Neuropathy: A Phase III Randomized Double-Blind Placebo Controlled Study Completed NCT00516503 Phase 3 baclofen/amitriptyline/ketamine gel
16 Randomized Placebo Controlled Double Blind Study of Restasis Versus Placebo in Primary Prevention of Ocular GVHD After Allogeneic Stem Cell Transplantation Completed NCT00755040 Phase 3 cyclosporine ophthalmic emulsion
17 HSCT-CHESS to Enhance Hematopoietic Transplant Recovery Completed NCT00782145 Phase 3
18 Protocol for Patients With High Risk (Resistant, Refractory, Relapsed or Adverse Cytogenetic) AML Completed NCT00005863 Phase 3 cytarabine;daunorubicin hydrochloride;etoposide;fludarabine phosphate;tretinoin
19 A Randomized Trial for Patients With Acute Myeloid Leukemia or High Risk Myelodysplatic Syndrome Aged 60 or Over Completed NCT00005823 Phase 3 cytarabine;daunorubicin hydrochloride;etoposide;hydroxyurea;idarubicin;mitoxantrone hydrochloride;thioguanine;tretinoin;valspodar
20 A Randomized, Double-blind, Placebo-controlled Study of the JAK Inhibitor INCB018424 Tablets Administered Orally to Subjects With Primary Myelofibrosis, Post-Polycythemia Vera Myelofibrosis or Post-Essential Thrombocythemia Myelofibrosis Completed NCT00952289 Phase 3 Ruxolitinib;Placebo
21 A Randomized Multicentre Study Comparing G-CSF Mobilized Peripheral Blood and G-CSF Stimulated Bone Marrow in Patients Undergoing Matched Sibling Transplantation for Hematologic Malignancies Completed NCT00438958 Phase 3
22 A Phase III Randomized, Double-Blind, Placebo-Controlled Study to Evaluate the Effects of Fragmin (5,000 IU Subcutaneously) in Preventing Catheter-Related Complications When Given Daily to Cancer Patients With Central Venous Catheters Completed NCT00006083 Phase 3 Fragmin
23 A PROSPECTIVE RANDOMIZED, DOUBLE-BLIND, COMPARATIVE, MULTICENTER STUDY TO EVALUATE EFFICACY AND SAFETY OF NYSTATIN AND AMPHOTERICIN B FOR EMPIRIC ANTIFUNGAL TREATMENT IN NEUTROPENIC PATIENTS Completed NCT00002742 Phase 3 amphotericin B deoxycholate;nystatin
24 Phase III, Randomized, Double-Blind, Placebo-Controlled Crossover Trial of Ondansetron in the Control of Chronic Nausea and Vomiting Not Due to Antineoplastic Therapy in Patients With Advanced Cancer Completed NCT00006348 Phase 3 ondansetron
25 Allogeneic Blood or Marrow Transplantation for Hematologic Malignancy and Aplastic Anemia Completed NCT00003816 Phase 2, Phase 3 busulfan;carboplatin;cyclophosphamide;etoposide;fludarabine phosphate;melphalan;thiotepa
26 A Phase III Randomized Double-Blind Study of Erythropoietin Versus Placebo in Anemic Patients With Cancer Undergoing Chemotherapy Completed NCT00003600 Phase 3
27 Does Hypericum Reduce Fatigue in Cancer Patients on Chemotherapy? A Randomized, Double-Blind, Placebo-Controlled Clinical Trial Completed NCT00005805 Phase 3
28 A Phase III Double-Blind Equivalence Study of Two Different Formulations of Slow-Release Morphine Followed by a Randomization Between Dextromethorphan or Placebo Plus Statex SR for Chronic Cancer Pain Relief in Terminally Ill Patients Completed NCT00003687 Phase 3 dextromethorphan hydrobromide;morphine sulfate
29 A Phase III Randomized, Multicenter Trial Comparing G-CSF Mobilized Peripheral Blood Stem Cell With Marrow Transplantation From Human Leukocyte Antigen (HLA) Compatible Unrelated Donors (BMT CTN #0201) Completed NCT00075816 Phase 3
30 Phase III Trial of T Lymphocyte Depletion by Elutriation and CD34 Add-Back for Allogeneic Bone Marrow Transplantation Completed NCT00265837 Phase 3
31 A Phase 3, Double-blind, Randomized Study to Compare the Efficacy and Safety of Luspatercept (ACE-536) Versus Placebo in Subjects With Myeloproliferative Neoplasm-Associated Myelofibrosis on Concomitant JAK Inhibitor Therapy and Who Require Red Blood Cell Transfusions Recruiting NCT04717414 Phase 3 ACE-536
32 A Phase 3b, Open-label, Single-arm, Rollover Study to Evaluate Long-term Safety in Subjects Who Have Participated in Other Luspatercept (ACE-536) Clinical Trials Recruiting NCT04064060 Phase 3 Luspatercept
33 Aprepitant Versus Hydroxyzine in Association With Cytoreductive Treatments for Patients With Myeloproliferative Neoplasia Suffering From Persistent Aquagenic Pruritus. Recruiting NCT03808805 Phase 3 Aprepitant 80 mg;Hydroxyzine 25mg;Placebo of Hydroxyzine;Placebo of Aprepitant
34 Haploidentical Allogeneic Peripheral Blood Transplantation: Clinical Trial and Laboratory Correlates Examining Checkpoint Immune Regulators' Expression Recruiting NCT03480360 Phase 3 Cyclophosphamide;Fludarabine;Tacrolimus;cellcept;g-csf
35 AVAJAK: Apixaban/Rivaroxaban Versus Aspirin for Primary Prevention of Thrombo-embolic Complications in JAK2V617F-positive Myeloproliferative Neoplasms Recruiting NCT05198960 Phase 3 Direct Oral Anticoagulants;Low-dose aspirin
36 Tacrolimus, Mini-dose Methotrexate and Mycophenolate Mofetil Versus Tacrolimus and Methotrexate for the Prevention of Acute Graft-versus-Host-Disease Active, not recruiting NCT01951885 Phase 3 tacrolimus;methotrexate;Mycophenolate mofetil;Methotrexate (low dose)
37 Risk-Stratified Therapy for Acute Myeloid Leukemia in Down Syndrome Active, not recruiting NCT02521493 Phase 3 Asparaginase;Asparaginase Erwinia chrysanthemi;Cytarabine;Daunorubicin Hydrochloride;Etoposide;Mitoxantrone Hydrochloride;Thioguanine
38 PRO#1278: A Phase III Study of Fludarabine and Busulfan Versus Fludarabine, Busulfan and Low Dose Total Body Irradiation in Patients Receiving an Allogeneic Hematopoietic Stem Cell Transplant Active, not recruiting NCT01366612 Phase 3 Fludarabine and Busulfan plus/minus Total Body Irradiation (low dose);Fludarabine and Busulfan + Low Dose Total Body Irradiation (LD TBI)
39 Randomized, Double Blinded, Placebo-Controlled Trial of Antibacterial Prophylaxis for the Prevention of Bacterial Infections in the Post-Engraftment Phase After Allogeneic Hematopoeitic Stem Cell Transplantation Terminated NCT00324324 Phase 3 moxifloxacin hydrochloride;Placebo
40 An Open-label, Uncontrolled, Multicenter, Multinational Study on the Efficacy and Safety of Administration of Donor Lymphocytes Depleted of Alloreactive T-cells (ATIR), Through the Use of TH9402 and Light Treatment in an ex Vivo Process, in Patients Receiving a CD34-selected Peripheral Blood Stem Cell Graft From a Related, Haploidentical Donor Terminated NCT00967343 Phase 2, Phase 3
41 Randomized Study to Compare Post Bone Marrow Transplant Cyclophosphamide With the Combination of Methotrexate Plus Calcineurin Inhibitor for Graft Versus Host Disease Prophylaxis Terminated NCT01749111 Phase 3 ARM A Cyclophosphamide;ARM B Calcineurin inhibitor and methotrexate
42 Treatment of Transient Myeloproliferative Disorder (TMD) in Children With Down Syndrome (DS) Withdrawn NCT00411281 Phase 3 cytarabine
43 A Phase 1b/2 Study to Evaluate the Safety and Efficacy of APR-246 in Combination With Azacitidine for the Treatment of Mutation TP53 (TP53) Mutant Myeloid Neoplasms Unknown status NCT03588078 Phase 1, Phase 2 APR-246;Azacitidine
44 Dual Vaccine Trial in Myeloproliferative Neoplasms Unknown status NCT04051307 Phase 1, Phase 2 PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL;Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
45 A Multiinstitutional Trial To Evaluate The Prophylactic Use Of NASA-Developed Light Emitting Diodes For The Prevention Of Oral Mucositis In Bone Marrow Transplant Patients Unknown status NCT00036712 Phase 2
46 Transplantation Using Umbilical Cord And Placental Blood Unknown status NCT00008164 Phase 2
47 Open Label Pilot Phase II Study of STI571 in the Treatment of Patients With Idiopathic Hypereosinophilic Syndrome (HES) and Eosinophilic Leukemias Unknown status NCT00276926 Phase 2 STI571
48 A Randomized Clinical Trial to Assess the Impact of a Remotely Administered Diet Intervention on Symptom Burden and Inflammatory Cytokines in Myeloproliferative Neoplasm: Feasibility Phase Completed NCT04744974 Phase 2
49 Multicenter Phase I/II Trial of Ruxolitinib in Combination With Decitabine in Patients With Accelerated Phase Myeloproliferative Neoplasm (MPN) or Post-MPN AML Completed NCT02076191 Phase 1, Phase 2 Ruxolitinib;Decitabine
50 Phase I/II Study of Ruxolitinib Plus Decitabine in Patients With Post Myeloproliferative Neoplasm - Acute Myeloid Leukemia (AML) Completed NCT02257138 Phase 1, Phase 2 Decitabine;Ruxolitinib Phosphate

Search NIH Clinical Center for Myeloproliferative Neoplasm

Inferred drug relations via UMLS 71 / NDF-RT 50 :


Sodium phenylbutyrate

Genetic Tests for Myeloproliferative Neoplasm

Genetic tests related to Myeloproliferative Neoplasm:

# Genetic test Affiliating Genes
1 Myeloproliferative Disorder 28
2 Myeloproliferative Neoplasm 28

Anatomical Context for Myeloproliferative Neoplasm

Organs/tissues related to Myeloproliferative Neoplasm:

MalaCards : Bone Marrow, Myeloid, Bone, T Cells, Lymph Node, Liver, Nk Cells

Publications for Myeloproliferative Neoplasm

Articles related to Myeloproliferative Neoplasm:

(show top 50) (show all 9986)
# Title Authors PMID Year
1
Imatinib sensitivity as a consequence of a CSF1R-Y571D mutation and CSF1/CSF1R signaling abnormalities in the cell line GDM1. 53 62 5
18971950 2009
2
Molecular drug targets in myeloproliferative neoplasms: mutant ABL1, JAK2, MPL, KIT, PDGFRA, PDGFRB and FGFR1. 53 62 5
19175693 2009
3
Nonfamilial, MPL S505N-Mutated Essential Thrombocythaemia. 62 5
23970983 2013
4
Genetic resistance to JAK2 enzymatic inhibitors is overcome by HSP90 inhibition. 62 5
22271575 2012
5
Deep sequencing reveals double mutations in cis of MPL exon 10 in myeloproliferative neoplasms. 62 5
21228032 2011
6
CYT387, a novel JAK2 inhibitor, induces hematologic responses and normalizes inflammatory cytokines in murine myeloproliferative neoplasms. 62 5
20385788 2010
7
A germline JAK2 SNP is associated with predisposition to the development of JAK2(V617F)-positive myeloproliferative neoplasms. 62 5
19287384 2009
8
New mutations of MPL in primitive myelofibrosis: only the MPL W515 mutations promote a G1/S-phase transition. 62 5
18528423 2008
9
MPL mutations in myeloproliferative disorders: analysis of the PT-1 cohort. 62 5
18451306 2008
10
JAK2 exon 12 mutations in polycythemia vera and idiopathic erythrocytosis. 62 5
17267906 2007
11
Acquired mutation of the tyrosine kinase JAK2 in human myeloproliferative disorders. 62 5
15781101 2005
12
Whole-genome sequencing of patients with rare diseases in a national health system. 5
32581362 2020
13
Prospective enterprise-level molecular genotyping of a cohort of cancer patients. 5
25157968 2014
14
Tumour cell responses to new fibroblast growth factor receptor tyrosine kinase inhibitors and identification of a gatekeeper mutation in FGFR3 as a mechanism of acquired resistance. 5
22869148 2013
15
Preclinical characterization of atiprimod, a novel JAK2 AND JAK3 inhibitor. 5
20372971 2011
16
Constitutively active FGFR3 with Lys650Glu mutation enhances bortezomib sensitivity in plasma cell malignancy. 5
21273588 2011
17
JAK2 V617F constitutive activation requires JH2 residue F595: a pseudokinase domain target for specific inhibitors. 5
20585391 2010
18
Bortezomib therapeutic effect is associated with expression of FGFR3 in multiple myeloma cells. 5
19331127 2009
19
Sustained expression of microRNA-155 in hematopoietic stem cells causes a myeloproliferative disorder. 62 46
18299402 2008
20
Ruxolitinib, a selective JAK1 and JAK2 inhibitor for the treatment of myeloproliferative neoplasms and psoriasis. 53 62
20506062 2010
21
Bone marrow morphologic features in polycythemia vera with JAK2 exon 12 mutations. 53 62
20472853 2010
22
Persistent localized bone marrow aplasia after radiotherapy with preserved peripheral counts: a study of 8 cases. 53 62
20471561 2010
23
Triptolide inhibits Jak2 transcription and induces apoptosis in human myeloproliferative disorder cells bearing Jak2V617F through caspase-3-mediated cleavage of Mcl-1. 53 62
19942343 2010
24
A new potential oncogenic mutation in the FERM domain of JAK2 in BCR/ABL1-negative and V617F-negative chronic myeloproliferative neoplasms revealed by a comprehensive screening of 17 tyrosine kinase coding genes. 53 62
20417861 2010
25
Activation of JAK2-V617F by components of heterodimeric cytokine receptors. 53 62
20363735 2010
26
Screening for diverse PDGFRA or PDGFRB fusion genes is facilitated by generic quantitative reverse transcriptase polymerase chain reaction analysis. 53 62
20107158 2010
27
Screening for MPL mutations in essential thrombocythemia and primary myelofibrosis: normal Mpl expression and absence of constitutive STAT3 and STAT5 activation in MPLW515L-positive platelets. 53 62
20113333 2010
28
Postsplenectomy sclerosing extramedullary hematopoietic tumor with unexpected good clinical evolution: morphologic, immunohistochemical, and molecular analysis of one case and review of the literature. 53 62
20042850 2010
29
Efficacy of the JAK2 inhibitor INCB16562 in a murine model of MPLW515L-induced thrombocytosis and myelofibrosis. 53 62
20154217 2010
30
Two routes to leukemic transformation after a JAK2 mutation-positive myeloproliferative neoplasm. 53 62
20008300 2010
31
Preclinical characterization of the selective JAK1/2 inhibitor INCB018424: therapeutic implications for the treatment of myeloproliferative neoplasms. 53 62
20130243 2010
32
Mutational analysis in BCR-ABL-negative classic myeloproliferative neoplasms: impact on prognosis and therapeutic choices. 53 62
20214447 2010
33
Quantitative assay for the detection of the V617F variant in the Janus kinase 2 (JAK2) gene using the Luminex xMAP technology. 53 62
20359349 2010
34
CD72 negatively regulates KIT-mediated responses in human mast cells. 53 62
20100931 2010
35
The current status and the future of JAK2 inhibitors for the treatment of myeloproliferative diseases. 53 62
20191331 2010
36
JAK2 and MPL gene mutations in V617F-negative myeloproliferative neoplasms. 53 62
19643476 2010
37
Clonal analysis of TET2 and JAK2 mutations suggests that TET2 can be a late event in the progression of myeloproliferative neoplasms. 53 62
20061559 2010
38
Molecular markers guide diagnosis and treatment in Philadelphia chromosome-negative myeloproliferative disorders (Review). 53 62
20126996 2010
39
Distinct patterns of cytogenetic and clinical progression in chronic myeloproliferative neoplasms with or without JAK2 or MPL mutations. 53 62
20113830 2010
40
Induction of myeloproliferative disorder and myelofibrosis by thrombopoietin receptor W515 mutants is mediated by cytosolic tyrosine 112 of the receptor. 53 62
19996410 2010
41
Molecular studies reveal that A134T, G156A and G1333A SNPs in the CD177 gene are associated with atypical expression of human neutrophil antigen-2. 53 62
19695014 2010
42
Redefining the role of interferon in the treatment of malignant diseases. 53 62
19906524 2010
43
JAK2 germline genetic variation affects disease susceptibility in primary myelofibrosis regardless of V617F mutational status: nullizygosity for the JAK2 46/1 haplotype is associated with inferior survival. 53 62
19847199 2010
44
[Budd-Chiari syndrome and splanchnic vein thrombosis: masked myeloproliferative neoplasms and JAK2V617F]. 53 62
20499034 2010
45
The JAK2 46/1 haplotype confers susceptibility to essential thrombocythemia regardless of JAK2V617F mutational status-clinical correlates in a study of 226 consecutive patients. 53 62
19847198 2010
46
A regulating role of the JAK2 FERM domain in hyperactivation of JAK2(V617F). 53 62
19929856 2010
47
Fusion of PDGFRB to two distinct loci at 3p21 and a third at 12q13 in imatinib-responsive myeloproliferative neoplasms. 53 62
20085582 2010
48
JAK2 mutation and thrombosis in the myeloproliferative neoplasms. 53 62
20425393 2010
49
JAK2 mutation in a patient with CLL with coexistent myeloproliferative neoplasm (MPN). 53 62
19625083 2009
50
Malignant diseases in Noonan syndrome and related disorders. 53 62
20029231 2009

Variations for Myeloproliferative Neoplasm

ClinVar genetic disease variations for Myeloproliferative Neoplasm:

5 (show all 13)
# Gene Name Type Significance ClinVarId dbSNP ID Position
1 JAK2, INSL6 NM_004972.4(JAK2):c.1849G>T (p.Val617Phe) SNV Pathogenic/Likely Pathogenic
14662 rs77375493 GRCh37: 9:5073770-5073770
GRCh38: 9:5073770-5073770
2 JAK2, INSL6 NM_004972.4(JAK2):c.1691G>T (p.Arg564Leu) SNV Likely Pathogenic
376706 rs368927897 GRCh37: 9:5072541-5072541
GRCh38: 9:5072541-5072541
3 MPL NM_005373.3(MPL):c.1513A>T (p.Ser505Cys) SNV Likely Pathogenic
376029 rs1057519752 GRCh37: 1:43814978-43814978
GRCh38: 1:43349307-43349307
4 MPL NM_005373.3(MPL):c.1514G>A (p.Ser505Asn) SNV Likely Pathogenic
14163 rs121913614 GRCh37: 1:43814979-43814979
GRCh38: 1:43349308-43349308
5 JAK2, INSL6 NM_004972.4(JAK2):c.2624C>A (p.Thr875Asn) SNV Likely Pathogenic
376705 rs1057520016 GRCh37: 9:5089726-5089726
GRCh38: 9:5089726-5089726
6 CSF1R NM_001288705.3(CSF1R):c.1711T>G (p.Tyr571Asp) SNV Likely Pathogenic
376166 rs1057519802 GRCh37: 5:149441328-149441328
GRCh38: 5:150061765-150061765
7 JAK2, INSL6 NM_004972.4(JAK2):c.2047A>G (p.Arg683Gly) SNV Likely Pathogenic
375951 rs1057519721 GRCh37: 9:5078360-5078360
GRCh38: 9:5078360-5078360
8 DNMT3A NM_022552.5(DNMT3A):c.2204A>G (p.Tyr735Cys) SNV Likely Pathogenic
812892 rs147828672 GRCh37: 2:25463289-25463289
GRCh38: 2:25240420-25240420
9 JAK2, ZBTB20 t(3;9)(q13.31;p24.1) TRANS Likely Pathogenic
869413 GRCh37: 3:114069121-114069122
GRCh38:
10 JAK3 NM_000215.4(JAK3):c.1715C>T (p.Ala572Val) SNV Likely Pathogenic
376037 rs121913504 GRCh37: 19:17948009-17948009
GRCh38: 19:17837200-17837200
11 KIT NM_000222.3(KIT):c.1675G>A (p.Val559Ile) SNV Likely Pathogenic
376056 rs121913520 GRCh37: 4:55593609-55593609
GRCh38: 4:54727443-54727443
12 FGFR3 NM_000142.5(FGFR3):c.1657G>A (p.Val553Met) SNV Likely Pathogenic
376216 rs199544087 GRCh37: 4:1807488-1807488
GRCh38: 4:1805761-1805761
13 FGFR3 NM_000142.5(FGFR3):c.1118A>G (p.Tyr373Cys) SNV Likely Pathogenic
16342 rs121913485 GRCh37: 4:1806099-1806099
GRCh38: 4:1804372-1804372

Copy number variations for Myeloproliferative Neoplasm from CNVD:

6 (show all 39)
# CNVD ID Chromosome Start End Type Gene Symbol CNVD Disease
1 33241 1 43803475 43820135 Mutation MPL Myeloproliferative neoplasm
2 44192 10 53300000 71300000 Loss Myeloproliferative neoplasm
3 62279 12 107500000 132349534 Loss Myeloproliferative neoplasm
4 70916 12 66000000 69800000 Loss Myeloproliferative neoplasm
5 71420 12 69800000 91200000 Loss Myeloproliferative neoplasm
6 75262 13 18400000 31100000 Loss Myeloproliferative neoplasm
7 75265 13 18400000 72100000 Loss Myeloproliferative neoplasm
8 92698 15 42700000 55800000 Loss Myeloproliferative neoplasm
9 93011 15 47498995 47525965 Loss FGF7 Myeloproliferative neoplasm
10 106738 17 1 11200000 Loss Myeloproliferative neoplasm
11 108733 17 22200000 28800000 Loss Myeloproliferative neoplasm
12 109394 17 25800000 31800000 Deletion NF1 Myeloproliferative neoplasm
13 114437 17 47600000 54900000 Loss Myeloproliferative neoplasm
14 115165 17 55117687 55118542 Loss CLTC Myeloproliferative neoplasm
15 124069 19 1 19800000 Loss Myeloproliferative neoplasm
16 126326 19 18251575 18251854 Loss JUND Myeloproliferative neoplasm
17 127984 19 38473374 38495178 Loss CEBPA Myeloproliferative neoplasm
18 142294 2 221300000 230700000 Loss Myeloproliferative neoplasm
19 147392 2 64000000 83700000 Loss Myeloproliferative neoplasm
20 150691 20 40134805 41251971 Copy number PTPRT Myeloproliferative neoplasm
21 150692 20 41976905 42131668 Copy number TOX2 Myeloproliferative neoplasm
22 151958 20 27100000 62435964 Loss Myeloproliferative neoplasm
23 151974 20 27500000 63025520 Deletion L3MBTL1 Myeloproliferative neoplasm
24 158649 21 35044781 35543405 Loss RUNX1 Myeloproliferative neoplasm
25 164350 22 36286416 36295356 Translate CNTRL Myeloproliferative neoplasm
26 164841 22 39916010 39959748 Gain L3MBTL2 Myeloproliferative neoplasm
27 166129 3 1 8700000 Loss Myeloproliferative neoplasm
28 170893 3 161200000 184200000 Loss Myeloproliferative neoplasm
29 177254 3 54400000 71800000 Loss Myeloproliferative neoplasm
30 179193 3 8700000 30800000 Gain Myeloproliferative neoplasm
31 192210 5 108662279 108714138 Gain PJA2 Myeloproliferative neoplasm
32 196632 5 17000000 76400000 Loss Myeloproliferative neoplasm
33 199864 5 44387421 44399741 Loss FGF10 Myeloproliferative neoplasm
34 227798 7 7200000 19500000 Loss Myeloproliferative neoplasm
35 230718 8 1 12700000 Loss Myeloproliferative neoplasm
36 233709 8 12700000 19100000 Loss Myeloproliferative neoplasm
37 241221 8 59800000 106100000 Loss Myeloproliferative neoplasm
38 244938 9 1 49000000 LOH JAK2 Myeloproliferative neoplasm
39 246129 9 116700000 129300000 Loss Myeloproliferative neoplasm

Expression for Myeloproliferative Neoplasm

Search GEO for disease gene expression data for Myeloproliferative Neoplasm.

Pathways for Myeloproliferative Neoplasm

Pathways related to Myeloproliferative Neoplasm according to GeneCards Suite gene sharing:

(show top 50) (show all 58)
# Super pathways Score Top Affiliating Genes
1
Show member pathways
13.79 THPO STAT5A PDGFRB PDGFRA KIT JAK3
2
Show member pathways
13.78 ABL1 DNMT3A ETV6 FGFR3 FLT3 JAK2
3 13.76 STAT5A PDGFRB PDGFRA KIT JAK3 JAK2
4
Show member pathways
13.67 THPO STAT5A PDGFRB PDGFRA KIT JAK3
5
Show member pathways
13.61 CSF1R FGFR3 FLT3 JAK2 JAK3 KIT
6
Show member pathways
13.45 ABL1 FGFR3 JAK2 JAK3 MPL PDGFRA
7
Show member pathways
13.43 CSF1R FGFR3 FLT3 JAK2 JAK3 KIT
8
Show member pathways
13.34 ETV6 FGFR3 FLT3 JAK2 JAK3 KIT
9
Show member pathways
13.34 CSF1R FGFR3 FLT3 JAK2 JAK3 KIT
10
Show member pathways
13.31 THPO PDGFRB PDGFRA KIT FLT3 FGFR3
11
Show member pathways
13.28 THPO PDGFRB PDGFRA KIT JAK2 FGFR3
12
Show member pathways
13.26 THPO PDGFRB PDGFRA KIT FLT3 FGFR3
13
Show member pathways
13.04 THPO PDGFRB PDGFRA KIT JAK2 FGFR3
14
Show member pathways
12.94 PDGFRB PDGFRA KIT FLT3 FGFR3 CSF1R
15
Show member pathways
12.9 STAT5A PDGFRB PDGFRA JAK3 JAK2
16
Show member pathways
12.89 PDGFRB PDGFRA KIT JAK3 JAK2 FLT3
17
Show member pathways
12.85 PDGFRB PDGFRA JAK3 JAK2 FGFR3
18
Show member pathways
12.83 THPO STAT5A MPL JAK3 JAK2
19 12.75 STAT5A PDGFRB PDGFRA KIT JAK3 JAK2
20 12.68 CSF1R FGFR3 FLT3 KIT PDGFRA PDGFRB
21
Show member pathways
12.67 PDGFRB PDGFRA KIT FLT3 FGFR3
22 12.55 STAT5A MPL KIT JAK3 JAK2 GATA1
23
Show member pathways
12.44 PDGFRB PDGFRA KIT FGFR3
24
Show member pathways
12.29 THPO STAT5A PDGFRB PDGFRA KIT FLT3
25
Show member pathways
12.27 STAT5A JAK3 JAK2 CSF1R
26
Show member pathways
12.26 ABL1 JAK2 PDGFRB STAT5A
27
Show member pathways
12.2 PDGFRB PDGFRA FGFR3 CSF1R
28
Show member pathways
12.16 THPO STAT5A PDGFRB PDGFRA KIT JAK3
29
Show member pathways
12.14 STAT5A JAK3 JAK2
30 12.06 PDGFRB PDGFRA KIT FLT3 FGFR3 CSF1R
31 12 THPO MPL KIT FLT3
32
Show member pathways
11.97 STAT5A KIT JAK2
33 11.91 THPO STAT5A MPL JAK2
34
Show member pathways
11.89 STAT5A KIT JAK2
35
Show member pathways
11.84 STAT5A JAK3 JAK2
36 11.83 PDGFRB PDGFRA FGFR3
37
Show member pathways
11.82 PDGFRA PDGFRB STAT5A
38 11.77 KIT GATA1 CSF1R
39
Show member pathways
11.76 FLT3 KIT PDGFRB
40
Show member pathways
11.76 PDGFRB PDGFRA KIT FLT3 FGFR3 CSF1R
41 11.73 KIT FLT3 CSF1R
42 11.71 THPO PDGFRB PDGFRA FGFR3
43
Show member pathways
11.68 PDGFRB PDGFRA KIT ABL1
44 11.64 STAT5A JAK3 JAK2
45 11.57 PDGFRB JAK3 JAK2 FGFR3
46 11.5 STAT5A JAK3 JAK2
47 11.48 PDGFRB PDGFRA FGFR3
48
Show member pathways
11.48 STAT5A PDGFRB JAK3 CSF1R
49 11.46 PDGFRB PDGFRA FGFR3
50 11.43 ABL1 CSF1R JAK2 PDGFRB STAT5A

GO Terms for Myeloproliferative Neoplasm

Cellular components related to Myeloproliferative Neoplasm according to GeneCards Suite gene sharing:

# Name GO ID Score Top Affiliating Genes
1 receptor complex GO:0043235 9.4 PDGFRB PDGFRA KIT FLT3 FGFR3 CSF1R

Biological processes related to Myeloproliferative Neoplasm according to GeneCards Suite gene sharing:

(show all 37)
# Name GO ID Score Top Affiliating Genes
1 positive regulation of cell population proliferation GO:0008284 10.38 CSF1R FGFR3 FLT3 JAK2 KIT MPL
2 positive regulation of ERK1 and ERK2 cascade GO:0070374 10.36 ABL1 CSF1R FGFR3 PDGFRA PDGFRB THPO
3 positive regulation of cell migration GO:0030335 10.34 PDGFRB PDGFRA KIT JAK2 CSF1R
4 positive regulation of cytosolic calcium ion concentration GO:0007204 10.3 PDGFRA JAK3 JAK2 GATA1 ABL1
5 protein phosphorylation GO:0006468 10.29 PDGFRB PDGFRA KIT JAK3 JAK2 FLT3
6 transmembrane receptor protein tyrosine kinase signaling pathway GO:0007169 10.27 PDGFRB PDGFRA KIT FLT3 FGFR3 CSF1R
7 cytokine-mediated signaling pathway GO:0019221 10.25 CSF1R FLT3 JAK2 JAK3 KIT MPL
8 positive regulation of phosphatidylinositol 3-kinase signaling GO:0014068 10.24 PDGFRB PDGFRA KIT JAK2 FLT3
9 hemopoiesis GO:0030097 10.22 MPL KIT FLT3 CSF1R
10 positive regulation of tyrosine phosphorylation of STAT protein GO:0042531 10.22 CSF1R FGFR3 FLT3 JAK2 KIT
11 positive regulation of MAPK cascade GO:0043410 10.21 THPO PDGFRB PDGFRA KIT JAK2 FLT3
12 erythrocyte differentiation GO:0030218 10.19 KIT JAK3 JAK2 GATA1
13 regulation of cell population proliferation GO:0042127 10.16 ABL1 CSF1R FLT3 KIT STAT5A
14 positive regulation of fibroblast proliferation GO:0048146 10.14 PDGFRB PDGFRA ABL1
15 platelet aggregation GO:0070527 10.14 PDGFRA MPL GATA1
16 phosphatidylinositol-mediated signaling GO:0048015 10.13 PDGFRB PDGFRA CSF1R
17 receptor signaling pathway via JAK-STAT GO:0007259 10.13 STAT5A JAK3 JAK2
18 phosphorylation GO:0016310 10.11 PDGFRB PDGFRA KIT JAK3 JAK2 FLT3
19 regulation of actin cytoskeleton reorganization GO:2000249 10.1 PDGFRA CSF1R ABL1
20 positive regulation of kinase activity GO:0033674 10.1 PDGFRB PDGFRA KIT FLT3 FGFR3 CSF1R
21 platelet-derived growth factor receptor signaling pathway GO:0048008 10.09 ABL1 JAK2 PDGFRA PDGFRB
22 positive regulation of phosphatidylinositol 3-kinase activity GO:0043552 10.07 PDGFRB PDGFRA KIT FLT3 FGFR3
23 growth hormone receptor signaling pathway via JAK-STAT GO:0060397 10.05 STAT5A JAK3 JAK2
24 positive regulation of phospholipase C activity GO:0010863 10.04 PDGFRB PDGFRA KIT
25 retina vasculature development in camera-type eye GO:0061298 9.97 PDGFRB PDGFRA
26 enzyme-linked receptor protein signaling pathway GO:0007167 9.97 JAK3 JAK2
27 myeloid progenitor cell differentiation GO:0002318 9.96 KIT FLT3
28 platelet-derived growth factor receptor-beta signaling pathway GO:0035791 9.95 ABL1 PDGFRB
29 thrombopoietin-mediated signaling pathway GO:0038163 9.94 THPO MPL
30 positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway GO:0038091 9.93 PDGFRA PDGFRB
31 metanephric glomerular capillary formation GO:0072277 9.93 PDGFRA PDGFRB
32 vascular endothelial growth factor signaling pathway GO:0038084 9.9 PDGFRB PDGFRA FLT3
33 protein autophosphorylation GO:0046777 9.86 PDGFRB PDGFRA KIT JAK2 FLT3 FGFR3
34 positive regulation of response to stimulus GO:0048584 9.73 KIT FLT3 CSF1R
35 multicellular organism development GO:0007275 9.73 PDGFRB PDGFRA KIT FLT3 FGFR3 CSF1R
36 peptidyl-tyrosine phosphorylation GO:0018108 9.58 PDGFRB PDGFRA KIT JAK3 JAK2 FLT3
37 positive regulation of protein modification process GO:0031401 9.46 CSF1R FLT3 KIT PDGFRB

Molecular functions related to Myeloproliferative Neoplasm according to GeneCards Suite gene sharing:

(show all 12)
# Name GO ID Score Top Affiliating Genes
1 ATP binding GO:0005524 10.46 PDGFRB PDGFRA KIT JAK3 JAK2 FLT3
2 nucleotide binding GO:0000166 10.02 PDGFRB PDGFRA KIT JAK3 JAK2 FLT3
3 transferase activity GO:0016740 10.02 ABL1 CSF1R DNMT3A FGFR3 FLT3 JAK2
4 kinase activity GO:0016301 9.96 PDGFRB PDGFRA KIT JAK3 JAK2 FLT3
5 non-membrane spanning protein tyrosine kinase activity GO:0004715 9.95 JAK3 JAK2 ABL1
6 growth factor binding GO:0019838 9.93 FLT3 PDGFRA PDGFRB
7 protein kinase activity GO:0004672 9.93 PDGFRB PDGFRA KIT JAK3 JAK2 FLT3
8 SH2 domain binding GO:0042169 9.91 ABL1 JAK2 KIT
9 vascular endothelial growth factor receptor activity GO:0005021 9.8 PDGFRA FLT3
10 transmembrane receptor protein tyrosine kinase activity GO:0004714 9.73 CSF1R FGFR3 FLT3 KIT PDGFRA PDGFRB
11 vascular endothelial growth factor binding GO:0038085 9.71 PDGFRB PDGFRA
12 protein tyrosine kinase activity GO:0004713 9.55 PDGFRB PDGFRA KIT JAK3 JAK2 FLT3

Sources for Myeloproliferative Neoplasm

2 CDC
6 CNVD
8 Cosmic
9 dbSNP
10 DGIdb
16 EFO
17 ExPASy
18 FMA
19 GARD
27 GO
28 GTR
29 HMDB
30 HPO
31 ICD10
32 ICD10 via Orphanet
33 ICD11
34 ICD9CM
35 IUPHAR
36 LifeMap
38 LOVD
40 MedGen
43 MeSH
44 MESH via Orphanet
45 MGI
48 NCI
49 NCIt
50 NDF-RT
52 NINDS
53 Novoseek
55 ODiseA
56 OMIM via Orphanet
57 OMIM® (Updated 08-Dec-2022)
61 PubChem
62 PubMed
64 QIAGEN
69 SNOMED-CT via HPO
70 Tocris
71 UMLS
72 UMLS via Orphanet
Content
Loading form....