MCID: THR004
MIFTS: 53

Thrombocytosis

Categories: Blood diseases
Data Licensing
For inquiries, contact:

Aliases & Classifications for Thrombocytosis

MalaCards integrated aliases for Thrombocytosis:

Name: Thrombocytosis 11 75 28 53 5 43 14 71 75 33
Thrombocythaemia 11

Classifications:



External Ids:

Disease Ontology 11 DOID:2228
MeSH 43 D013922
NCIt 49 C35530
SNOMED-CT 68 165557006
UMLS 71 C0836924

Summaries for Thrombocytosis

Disease Ontology: 11 A blood platelet disease that is characterized by the presence of high platelet counts in the blood.

MalaCards based summary: Thrombocytosis, also known as thrombocythaemia, is related to refractory anemia and transient erythroblastopenia of childhood. An important gene associated with Thrombocytosis is JAK2 (Janus Kinase 2), and among its related pathways/superpathways are Innate Immune System and Signal Transduction. The drugs Benzocaine and Tannic acid have been mentioned in the context of this disorder. Affiliated tissues include myeloid, bone marrow and liver, and related phenotypes are homeostasis/metabolism and immune system

Wikipedia: 75 Thrombocythemia is a condition of high platelet (thrombocyte) count in the blood. Normal count is in the... more...

Related Diseases for Thrombocytosis

Diseases related to Thrombocytosis via text searches within MalaCards or GeneCards Suite gene sharing:

(show top 50) (show all 1000)
# Related Disease Score Top Affiliating Genes
1 refractory anemia 32.2 TET2 MPL EPO CSF3
2 transient erythroblastopenia of childhood 32.1 KITLG EPO
3 poems syndrome 31.9 IL6 IL1B EPO CSF3
4 essential thrombocythemia 31.7 THPO TET2 SELP PPBP MPL KITLG
5 splenomegaly 31.2 MPL JAK2 EPO
6 iron deficiency anemia 31.1 THPO IL6 IL11 EPO CRP
7 myelodysplastic/myeloproliferative neoplasm 31.0 TET2 JAK2 CSF2
8 myeloid leukemia 30.7 TET2 LIF KITLG JAK2 IL3 CSF3
9 paraneoplastic syndromes 30.7 IL6 CSF3
10 temporal arteritis 30.6 JAK2 IL6 IL1B CSF2 CRP
11 neutrophilia, hereditary 30.6 JAK2 IL6 IL3 CSF3 CSF2 CRP
12 thrombophilia due to thrombin defect 30.6 SERPINC1 SELP F3 F2
13 thrombocytopenia due to platelet alloimmunization 30.5 THPO SELP MPL F3
14 bowel dysfunction 30.5 IL6 IL1B CRP
15 portal hypertension 30.5 THPO JAK2 F2
16 granulocytopenia 30.5 IL3 CSF3 CSF2
17 acquired von willebrand syndrome 30.5 JAK2 F3 F2
18 crohn's disease 30.5 IL6 IL1B CSF2 CRP
19 coronary thrombosis 30.5 SERPINC1 F3 CRP
20 myelofibrosis 30.5 THPO TET2 SELP MPL JAK2 IL3
21 leukemia 30.5 THPO MPL LIF JAK2 IL3 CSF2
22 chronic eosinophilic pneumonia 30.4 IL6 CSF3 CSF2
23 pulmonary embolism 30.4 SERPINC1 F3 F2 CRP
24 myeloproliferative neoplasm 30.4 THPO TET2 SELP PPBP MPL KITLG
25 pneumonia 30.4 IL6 IL1B CSF3 CSF2 CRP
26 factor viii deficiency 30.4 SERPINC1 F3 F2
27 pain agnosia 30.4 IL6 IL1B CRP
28 amegakaryocytic thrombocytopenia, congenital 30.4 THPO MPL JAK2 IL3
29 celiac disease 1 30.4 IL6 IL1B CSF2 CRP
30 pleural empyema 30.3 IL6 F2 CRP
31 osteomyelitis 30.3 IL6 IL1B CSF3 CRP
32 urinary tract infection 30.3 IL6 IL1B F3 F2 CRP
33 acute megakaryocytic leukemia 30.3 THPO MPL JAK2 IL3 IL11 CSF2
34 budd-chiari syndrome 30.3 SERPINC1 MPL JAK2 F3 F2
35 alcohol use disorder 30.3 IL6 IL1B F2 CRP
36 bronchiolitis 30.3 IL6 IL1B IL11 CSF2 CRP
37 stress polycythemia 30.3 JAK2 EPO
38 polycythemia 30.3 THPO TET2 PPBP MPL KITLG JAK2
39 angina pectoris 30.3 IL6 F3 CRP
40 bacterial meningitis 30.3 IL1B CSF3 CRP
41 spondylitis 30.3 IL6 IL1B CRP
42 acute leukemia 30.2 THPO MPL KITLG JAK2 IL3 EPO
43 osteosclerotic myeloma 30.2 IL6 IL1B
44 thyroiditis 30.2 IL6 IL1B CRP
45 thrombosis 30.2 SERPINC1 SELP PPBP MPL JAK2 F3
46 anemia, autoimmune hemolytic 30.2 IL6 EPO CRP
47 vasculitis 30.2 SELP IL6 IL1B CRP
48 pyuria 30.2 IL6 F2 CRP
49 myelodysplastic syndrome 30.2 THPO TET2 MPL KITLG JAK2 IL6
50 thrombocytopenic purpura, autoimmune 30.2 THPO SELP MPL IL11 F3 F2

Graphical network of the top 20 diseases related to Thrombocytosis:



Diseases related to Thrombocytosis

Symptoms & Phenotypes for Thrombocytosis

MGI Mouse Phenotypes related to Thrombocytosis:

45 (show all 11)
# Description MGI Source Accession Score Top Affiliating Genes
1 homeostasis/metabolism MP:0005376 10.36 CRP CSF2 EPO F2 F3 IL1B
2 immune system MP:0005387 10.32 CRP CSF2 CSF3 EPO F2 F3
3 cellular MP:0005384 10.28 CSF2 EPO F2 F3 IL3 IL6
4 cardiovascular system MP:0005385 10.22 CRP CSF2 EPO F2 F3 IL1B
5 neoplasm MP:0002006 10.1 CSF2 F3 IL1B IL3 IL6 JAK2
6 hematopoietic system MP:0005397 10.09 CSF2 CSF3 EPO F2 F3 IL1B
7 liver/biliary system MP:0005370 10.08 EPO IL6 JAK2 KITLG LIF SELP
8 respiratory system MP:0005388 10.02 CSF2 EPO F2 F3 IL3 IL6
9 skeleton MP:0005390 9.96 CSF2 F2 IL1B IL3 IL6 JAK2
10 mortality/aging MP:0010768 9.8 CSF2 EPO F2 F3 IL1B IL3
11 integument MP:0010771 9.32 CSF2 CSF3 F2 F3 IL1B IL6

Drugs & Therapeutics for Thrombocytosis

Drugs for Thrombocytosis (from DrugBank, HMDB, Dgidb, PharmGKB, IUPHAR, NovoSeek, BitterDB):

(show top 50) (show all 232)
# Name Status Phase Clinical Trials Cas Number PubChem Id
1
Benzocaine Approved, Investigational Phase 4 1994-09-7, 94-09-7 2337
2
Tannic acid Approved Phase 4 1401-55-4 16129878 16129778
3
Peginterferon alfa-2b Approved Phase 4 215647-85-1, 99210-65-8
4 Anti-Infective Agents Phase 4
5 Antiviral Agents Phase 4
6 Interferon alpha-2 Phase 4
7 Interferon-alpha Phase 4
8
Anagrelide Approved Phase 3 68475-42-3 2182 135409400
9
Hydroxyurea Approved Phase 3 127-07-1 3657
10
Peginterferon alfa-2a Approved, Investigational Phase 3 198153-51-4
11
Apixaban Approved Phase 3 503612-47-3 10182969
12
Acetylsalicylic acid Approved, Vet_approved Phase 3 50-78-2 2244
13
Sodium citrate Approved, Investigational Phase 3 68-04-2 23431961
14
Rivaroxaban Approved Phase 3 366789-02-8 9875401
15
Iron Approved Phase 3 7439-89-6 29936
16
Danazol Approved Phase 3 17230-88-5 28417
17
Lactitol Approved, Investigational Phase 2, Phase 3 585-86-4 157355
18
Citric acid Approved, Nutraceutical, Vet_approved Phase 3 77-92-9 311
19 Fibrinolytic Agents Phase 3
20 Platelet Aggregation Inhibitors Phase 3
21 Mitogens Phase 3
22 interferons Phase 3
23 Antirheumatic Agents Phase 3
24 Cyclooxygenase Inhibitors Phase 3
25 Anti-Inflammatory Agents, Non-Steroidal Phase 3
26 Androgens Phase 2, Phase 3
27 Analgesics, Non-Narcotic Phase 3
28 Anti-Inflammatory Agents Phase 3
29 Analgesics Phase 3
30 Antipyretics Phase 3
31 Anticoagulants Phase 3
32 Citrate Phase 3
33 Hormones Phase 3
34 Hormone Antagonists Phase 3
35 Estrogens Phase 3
36 Estrogen Receptor Antagonists Phase 3
37 Estrogen Antagonists Phase 3
38 Hepcidins Phase 3
39 Janus Kinase Inhibitors Phase 3
40
Levoleucovorin Approved, Experimental, Investigational Phase 2 68538-85-2, 58-05-9, 73951-54-9 149436 6006
41
Pembrolizumab Approved Phase 2 1374853-91-4 254741536
42
Miconazole Approved, Investigational, Vet_approved Phase 2 22916-47-8 4189
43
Clotrimazole Approved, Vet_approved Phase 2 23593-75-1 2812
44
Lenograstim Approved, Investigational Phase 2 135968-09-1
45
Methotrexate Approved Phase 2 1959-05-2, 59-05-2 4112 126941
46
Aldesleukin Approved Phase 1, Phase 2 110942-02-4
47
Lenalidomide Approved Phase 2 191732-72-6 216326
48
Prednisone Approved, Vet_approved Phase 2 53-03-2 5865
49
Pomalidomide Approved Phase 2 19171-19-8 134780
50
Thalidomide Approved, Investigational, Withdrawn Phase 2 50-35-1 5426

Interventional clinical trials:

(show top 50) (show all 181)
# Name Status NCT ID Phase Drugs
1 A Multicenter, Open-label, Clinical Study for Efficacy and Safety Evaluation of Anagrelide in Patients With Treatment-naïve, High-risk Essential Thrombocythemia as a Primary Treatment Completed NCT03232177 Phase 4 Anagre Cap.
2 A Phase IIIb, Randomized, Open Label Study to Compare the Safety, Efficacy and Tolerability of Anagrelide Hydrochloride Versus Hydroxyurea in High-Risk Essential Thrombocythaemia Patients. Completed NCT00202644 Phase 4 Anagrelide;Hydroxyurea
3 A UK Open-label, Multicentre, Exploratory Phase II Study of INC424 for Patients With Primary Myelofibrosis (PMF) or Post Polycythaemia Myelofibrosis (PPV MF) or Post Essential Thrombocythaemia Myelofibrosis (PET-MF) Completed NCT01558739 Phase 4 INC424
4 A Prospective, Single-center Clinical Trial of Pegylated Interferon Alfa-2b Versus Interferon Alfa Therapy in the Treatment of Childhood and Adolescent Essential Thrombocythemia Recruiting NCT04226950 Phase 4 Recombinant Interferon Alpha;Pegylated interferon alfa-2b
5 A Prospective, Multicenter, Randomized Controlled Clinical Trial of Pegylated Interferon Alfa-2b Versus Interferon Alfa Therapy in the Treatment of Adult Essential Thrombocythemia Recruiting NCT05395507 Phase 4 Recombinant Interferon Alpha;Pegylated interferon alfa-2b
6 French Aspirin Study in Essential Thrombocythemia: an Open and Randomized Study Unknown status NCT02611973 Phase 3 Hydroxyurea treatment (HU)
7 A Phase 3, Randomized Study To Evaluate the Efficacy of Momelotinib Versus Best Available Therapy in Anemic or Thrombocytopenic Subjects With Primary Myelofibrosis, Post-polycythemia Vera Myelofibrosis, or Post-essential Thrombocythemia Myelofibrosis Who Were Treated With Ruxolitinib Completed NCT02101268 Phase 3 Momelotinib;Best Available Therapy (BAT)
8 A Multicenter, Open-label Clinical Study of the JAK Inhibitor Ruxolitinib (INC424) in Patients With Primary Myelofibrosis, Post-polycythemia Vera Myelofibrosis, or Post-essential Thrombocythemia Myelofibrosis Completed NCT02087059 Phase 3 Ruxolitinib
9 A Phase III Randomized, Multicenter, Double-blind, Active Controlled Study to Compare the Efficacy and Safety of Two Different Anagrelide Formulations in Patients With Essential Thrombocythemia (TEAM-ET 2.0) Completed NCT02076815 Phase 3 Anagrelide retard;Thromboreductin
10 A Phase 3, Randomized, Double-blind Active-controlled Study Evaluating Momelotinib vs. Ruxolitinib in Subjects With Primary Myelofibrosis (PMF) or Post-Polycythemia Vera or Post-Essential Thrombocythemia Myelofibrosis (Post-PV/ET MF) Completed NCT01969838 Phase 3 Momelotinib;Ruxolitinib;Placebo to match momelotinib;Placebo to match ruxolitinib
11 A Single Blind, Multi-centre, Randomised Multinational Phase III Study to Compare the Efficacy and Tolerability of Anagrelide vs Hydroxyurea in Patients With Essential Thrombocythaemia Completed NCT01065038 Phase 3 Anagrelide;Hydroxyurea
12 Randomized Trial of Pegylated Interferon Alfa-2a Versus Hydroxyurea Therapy in the Treatment of High Risk Polycythemia Vera (PV) and High Risk Essential Thrombocythemia (ET) Completed NCT01259856 Phase 3 PEGASYS;Hydroxyurea;Aspirin
13 A Phase III, Randomized, Multicenter, Subject and Sponsor-blinded, Placebo Controlled Study to Compare the Efficacy and Safety of "Anagrelide Retard" Versus Placebo in "at Risk" Subjects With Essential Thrombocythaemia Completed NCT01230775 Phase 3 Anagrelide retard;Placebo
14 An Open-label, Multicenter, Expanded Access Study of INC424 for Patients With Primary Myelofibrosis (PMF) or Post Polycythemia Myelofibrosis (PPV MF) or Post-essential Thrombocythemia Myelofibrosis (PET-MF). Completed NCT01493414 Phase 3 INC424
15 A Phase 3, Multi-centre, Open-label, Extension Study to Investigate the Long-term Safety of SPD422 in Japanese Adults With Essential Thrombocythaemia Completed NCT01467661 Phase 3 SPD422 (anagrelide hydrochloride)
16 A Phase 3, Open-label, Single-arm Study Evaluating the Effect of SPD422 on Platelet Lowering and Safety in Japanese Adults With At Risk Essential Thrombocythaemia Who Are Intolerant or Refractory to Current Cytoreductive Treatment Completed NCT01214915 Phase 3 Anagrelide Hydrochloride
17 Danish Study of Low-dose Interferon Alpha Versus Hydroxyurea in the Treatment of Philadelphia Chromosome Negative (Ph-)Chronic Myeloid Neoplasms. Completed NCT01387763 Phase 3 PegIntron;Pegasys;Hydrea
18 A Phase 3, Open-Label, Multicenter, Randomized, Active-controlled Study to Assess Pharmacokinetics and Compare the Efficacy, Safety, and Tolerability of P1101 vs Anagrelide as Second Line Therapy for Essential Thrombocythemia Recruiting NCT04285086 Phase 3 Anagrelide
19 A Randomized, Double-Blind, Placebo-Controlled Study of the PI3Kδ Inhibitor Parsaclisib Plus Ruxolitinib in Participants With Myelofibrosis Who Have Suboptimal Response to Ruxolitinib Recruiting NCT04551053 Phase 3 parsaclisib;ruxolitinib;placebo
20 A Phase 3, Randomized, Double-blind, Active-Control Study of Pelabresib (CPI-0610) and Ruxolitinib vs. Placebo and Ruxolitinib in JAKi Treatment Naive MF Patients Recruiting NCT04603495 Phase 3 Pelabresib;Ruxolitinib;Placebo
21 A Phase 3, Randomized, Double-Blind, Placebo-Controlled Study of the Combination of PI3Kδ Inhibitor Parsaclisib and Ruxolitinib in Participants With Myelofibrosis Recruiting NCT04551066 Phase 3 parsaclisib;ruxolitinib;placebo
22 A Phase 2/3 Randomized, Controlled, Open-Label Study of KRT 232 in Subjects With Primary Myelofibrosis (PMF), Post Polycythemia Vera MF (Post-PV-MF), Or Post Essential Thrombocythemia MF (Post-ET-MF) Who Are Relapsed or Refractory to Janus Kinase (JAK) Inhibitor Treatment Recruiting NCT03662126 Phase 2, Phase 3 KRT-232;Best Available Therapy (BAT)
23 A Randomized, Controlled Phase 3 Study of Pacritinib Versus Physician's Choice in Patients With Primary Myelofibrosis, Post Polycythemia Vera Myelofibrosis, or Post-Essential Thrombocythemia Myelofibrosis With Severe Thrombocytopenia (Platelet Count <50,000/μL)(PACIFICA) Recruiting NCT03165734 Phase 3 Pacritinib;Physician's Choice medications
24 AVAJAK: Apixaban/Rivaroxaban Versus Aspirin for Primary Prevention of Thrombo-embolic Complications in JAK2V617F-positive Myeloproliferative Neoplasms Recruiting NCT05198960 Phase 3 Direct Oral Anticoagulants;Low-dose aspirin
25 A Phase 3, Multicenter, Open-label, Randomized Study to Evaluate the Efficacy and Safety of Fedratinib Compared to Best Available Therapy (BAT) in Subjects With DIPSS (Dynamic International Prognostic Scoring System)-Intermediate or High-risk Primary Myelofibrosis (PMF), Post-polycythemia Vera Myelofibrosis (Post-PV MF), or Post-essential Thrombocythemia Myelofibrosis (Post-ET MF) and Previously Treated With Ruxolitinib Recruiting NCT03952039 Phase 3 FEDRATINIB;Best Available Therapy (BAT)
26 A Phase 3b, Multicenter, Single-Arm, Open-Label Efficacy and Safety Study of Fedratinib in Subjects With DIPSS (Dynamic International Prognostic Scoring System)-Intermediate or High-Risk Primary Myelofibrosis (PMF), Post-Polycythemia Vera Myelofibrosis (Post-PV MF), or Post-Essential Thrombocythemia Myelofibrosis (Post-ET MF) and Previously Treated With Ruxolitinib Active, not recruiting NCT03755518 Phase 3 FEDRATINIB
27 A Randomized, Double-blind, Phase 3 Study to Evaluate the Activity of Momelotinib (MMB) Versus Danazol (DAN) in Symptomatic, Anemic Subjects With Primary Myelofibrosis (PMF), Post-polycythemia Vera (PV) Myelofibrosis, or Post-essential Thrombocythemia (ET) Myelofibrosis Who Were Previously Treated With JAK Inhibitor Therapy Active, not recruiting NCT04173494 Phase 3 Momelotinib;Danazol;Placebo to match momelotinib;Placebo to match danazol
28 A Randomized, Multicenter Phase IIb Study to Evaluate the Efficacy and Safety of Ruxolitinib Versus Best Available Therapy in Patients With High Risk Essential Thrombocythemia, Who Are Resistant or Intolerant to Hydroxyurea: A FIM Study Terminated NCT02962388 Phase 2, Phase 3 Anagrelide;Ruxolitinib (JAKAVI®);IFNα/ PegIFNα
29 A Randomized Controlled Phase 3 Study of Oral Pacritinib Versus Best Available Therapy in Patients With Thrombocytopenia and Primary Myelofibrosis, Post-Polycythemia Vera Myelofibrosis, or Post-Essential Thrombocythemia Myelofibrosis Terminated NCT02055781 Phase 3 Pacritinib;Best Available Therapy
30 A Randomized Controlled Phase 3 Study of Oral Pacritinib Versus Best Available Therapy in Patients With Primary Myelofibrosis, Post-Polycythemia Vera Myelofibrosis, or Post-Essential Thrombocythemia Myelofibrosis Terminated NCT01773187 Phase 3 Pacritinib;Best Available Therapy
31 A Multicenter, Open Label Phase I/II Study of CEP-701 (Lestaurtinib) in Adults With Myelofibrosis Unknown status NCT00668421 Phase 1, Phase 2 CEP-701 (Lestaurtinib)
32 A Phase II Study of MK-0683 in Patients With Polycythaemia Vera and Essential Thrombocythaemia. Unknown status NCT00866762 Phase 2 HDAC inhibitor (MK-0683)
33 Dual Vaccine Trial in Myeloproliferative Neoplasms Unknown status NCT04051307 Phase 1, Phase 2 PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL;Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
34 A Phase I/II Open Label Study of LBH589, a Novel Histone Deacetylase Inhibitor (HDACi), in Patients With Primary Myelofibrosis (PMF) and Post-polycythemia/Essential Thrombocythemia Myelofibrosis (Post-PV/ET MF) Unknown status NCT01298934 Phase 1, Phase 2 LBH589
35 A Phase 2, Open Label Efficacy and Safety Study of Anagrelide Controlled Release (CR) in Subjects With Thrombocytosis Secondary to Essential Thrombocythemia and Other Myeloproliferative Neoplasms (MPN) Completed NCT02125318 Phase 2 Anagrelide CR
36 Open Label Phase 2 Single Agent Study of LCL-161 in Patients With Primary Myelofibrosis (PMF), Post-Polycythemia Vera Myelofibrosis (Post-PV MF), or Post-Essential Thrombocytosis Myelofibrosis (Post-ET MF) Completed NCT02098161 Phase 2 Smac Mimetic LCL161
37 An Open-Label Study of Oral CEP-701 in Patients With Polycythemia Vera or Essential Thrombocytosis With the JAK2 V617F Mutation Completed NCT00586651 Phase 2 lestaurtinib
38 A Phase 1/2, Open-Label Study of the JAK2 Inhibitor INCB018424 Administered Orally to Patients With Primary Myelofibrosis (PMF) and Post Polycythemia Vera/Essential Thrombocythemia Myelofibrosis (Post-PV/ET) Completed NCT00509899 Phase 1, Phase 2 Ruxolitinib
39 A Phase Ib/II, Open-label, Multi-center, Dose-finding Study to Assess the Safety and Efficacy of the Oral Combination of LDE225 and INC424 (Ruxolitinib) in Patients With Myelofibrosis Completed NCT01787552 Phase 1, Phase 2 LDE225;INC424
40 Phase II Study of Shortened-duration Tacrolimus Following Nonmyeloablative Peripheral Blood Stem Cell Transplant With High-dose Posttransplantation Cyclophosphamide in Malignancies That Are Challenging to Engraft Completed NCT02556931 Phase 2 Fludarabine;Cyclophosphamide;Tacrolimus;Mycophenolate mofetil
41 A Phase 2, Prospective Study Of PRM-151 In Subjects With Primary Myelofibrosis (PMF), Post-Polycythemia Vera MF (Post-PV MF), Or Post-Essential Thrombocythemia MF (Post-ET MF) Completed NCT01981850 Phase 2 Ruxolitinib
42 A Phase 2 Open-Label, Dose-Ranging Study of the Efficacy and Safety of Orally Administered SAR302503 in Japanese Patients With Intermediate-2 or High Risk Primary Myelofibrosis, Post-Polycythemia Vera Myelofibrosis, Post-Essential Thrombocythemia Myelofibrosis With Splenomegaly Completed NCT01692366 Phase 2 SAR302503
43 A Phase II, Open-label, Multicentre, Pharmacokinetic, Pharmacodynamic and Safety Study of Anagrelide Hydrochloride in Young (18-50 Years) and Elderly (≥ 65 Years) Patients With Essential Thrombocythaemia. Completed NCT00413634 Phase 2 anagrelide hydrochloride
44 Low-Dose TBI Dose Escalation to Decrease Risks of Progression and Graft Rejection After Hematopoietic Cell Transplantation With Nonmyeloablative Conditioning as Treatment for Untreated Myelodysplastic Syndrome or Myeloproliferative Disorders - A Multi-Center Trial Completed NCT00397813 Phase 2 Cyclosporine;Fludarabine Phosphate;Mycophenolate Mofetil
45 A Phase II Study to Evaluate the Efficacy of Oral Beclomethasone Dipropionate for Prevention of Acute GVHD After Hematopoietic Cell Transplantation With Myeloablative Conditioning Regimens Completed NCT00489203 Phase 2 beclomethasone dipropionate;placebo;tacrolimus;methotrexate
46 PD-1 Inhibition in Advanced Myeloproliferative Neoplasms Completed NCT03065400 Phase 2 Pembrolizumab
47 A Multicenter Phase II, Open Label, Single Arm Study to Evaluate the Efficacy and Safety of Ruxolitinib in the Treatment of Anemic Myelofibrosis Patients. Completed NCT02966353 Phase 2 ruxolitinib
48 A Phase 1/2 Study of Oral SB1518 in Subjects With Chronic Idiopathic Myelofibrosis Completed NCT00745550 Phase 1, Phase 2 SB1518
49 Open-label Study to Assess the Long-term Safety and Efficacy of Momelotinib in Subjects With Primary Myelofibrosis, Post-polycythemia Vera Myelofibrosis, Post Essential Thrombocythemia Myelofibrosis, Polycythemia Vera or Essential Thrombocythemia Completed NCT02124746 Phase 2 Momelotinib
50 Phase II Trial of Triapine (NSC #663249, 3-Aminopyridine-2-Carboxaldehyde Thiosemicarbone) Plus Fludarabine (NSC #312887, Fludarabine Monophosphate) in Adults With Aggressive Myeloproliferative Disorders (MPDs) Including Chronic Myelomonocytic Leukemia (CMML) and Chronic Myelogenous Leukemia in Accelerated Phase (CML-AP) or Blast Crisis (CML-BC) Completed NCT00381550 Phase 2 fludarabine phosphate;triapine

Search NIH Clinical Center for Thrombocytosis

Inferred drug relations via UMLS 71 / NDF-RT 50 :


Chlorambucil
Uracil Mustard

Cochrane evidence based reviews: thrombocytosis

Genetic Tests for Thrombocytosis

Genetic tests related to Thrombocytosis:

# Genetic test Affiliating Genes
1 Thrombocytosis 28

Anatomical Context for Thrombocytosis

Organs/tissues related to Thrombocytosis:

MalaCards : Myeloid, Bone Marrow, Liver, Bone, Endothelial, Neutrophil, Lung

Publications for Thrombocytosis

Articles related to Thrombocytosis:

(show top 50) (show all 5626)
# Title Authors PMID Year
1
Clinical utility of routine MPL exon 10 analysis in the diagnosis of essential thrombocythaemia and primary myelofibrosis. 53 62
20151976 2010
2
Conditional expression of heterozygous or homozygous Jak2V617F from its endogenous promoter induces a polycythemia vera-like disease. 53 62
20197548 2010
3
Efficacy of the JAK2 inhibitor INCB16562 in a murine model of MPLW515L-induced thrombocytosis and myelofibrosis. 53 62
20154217 2010
4
JAK2 and MPL gene mutations in V617F-negative myeloproliferative neoplasms. 53 62
19643476 2010
5
Narrative review: Thrombocytosis, polycythemia vera, and JAK2 mutations: The phenotypic mimicry of chronic myeloproliferation. 53 62
20194236 2010
6
Mutations of JAK2 and TET2, but not CBL are detectable in a high portion of patients with refractory anemia with ring sideroblasts and thrombocytosis. 53 62
19903679 2010
7
Class prediction models of thrombocytosis using genetic biomarkers. 53 62
19773543 2010
8
[Diabetes insipidus followed, after 4 years, with dysarthria and mild right-sided hemiparesis--the first clinical signs of Erdheim-Chester disease. Description and depiction of a case with a review of information on the disease]. 53 62
20070034 2009
9
[Paediatric myofibroblastic tumours. A presentation of three cases]. 53 62
19647502 2009
10
JAK2 V617F mutation and PRV-1 overexpression: relevance in the diagnosis of polycythaemia vera and essential thrombocythaemia. 53 62
19999391 2009
11
Comparison of JAK2V617F mutation assessment employing different molecular diagnostic techniques. 53 62
19657484 2009
12
Granulocytosis and thrombocytosis in renal cell carcinoma: a pro-inflammatory cytokine response originating in the tumour. 53 62
19581670 2009
13
Thrombocytosis in EPO-treated dialysis patients may be mediated by EPO rather than iron deficiency. 53 62
19303685 2009
14
A case of acute promyelocytic leukemia showing transient thrombocytosis caused by increased interleukin-6 and thrombopoietin after treatment with all-trans retinoic acid and chemotherapy. 53 62
19461187 2009
15
Mutational inhibition of c-Myb or p300 ameliorates treatment-induced thrombocytopenia. 53 62
19252138 2009
16
The production of JAK2 wild-type platelets is not downregulated in patients with JAK2 V617F mutant-positive essential thrombocythaemia. 53 62
19222478 2009
17
[A case of IL-6 producing malignant mesothelioma of abdomen with thrombocytosis]. 53 62
19346724 2009
18
Incomplete restoration of Mpl expression in the mpl-/- mouse produces partial correction of the stem cell-repopulating defect and paradoxical thrombocytosis. 53 62
18796624 2009
19
Pronounced thrombocytosis in transgenic mice expressing reduced levels of Mpl in platelets and terminally differentiated megakaryocytes. 53 62
18845793 2009
20
Recurrent refractory arterial thromboembolism associated with the Janus kinase 2 V617F mutation. 53 62
19174256 2009
21
General changes in hemostasis in gastric cancer. 53 62
19507648 2009
22
Mice overexpressing murine oncostatin M (OSM) exhibit changes in hematopoietic and other organs that are distinct from those of mice overexpressing human OSM or bovine OSM. 53 62
19112126 2009
23
Familial thrombocytosis caused by the novel germ-line mutation p.Pro106Leu in the MPL gene. 53 62
19036112 2009
24
Thrombocytosis. 53 62
20008195 2009
25
Anagrelide: 20 years later. 53 62
19105705 2009
26
Erythropoietin, iron depletion, and relative thrombocytosis: a possible explanation for hemoglobin-survival paradox in hemodialysis. 53 62
18760517 2008
27
Familial chronic myeloproliferative disorders: the state of the art. 53 62
18484677 2008
28
A de novo splice donor mutation in the thrombopoietin gene causes hereditary thrombocythemia in a Polish family. 53 62
18367486 2008
29
Thrombosis with erythropoietic stimulating agents-does iron-deficient erythropoiesis play a role? 53 62
18397204 2008
30
Incidence and clinical significance of left ventricular thrombus in tako-tsubo cardiomyopathy assessed with echocardiography. 53 62
18334499 2008
31
High prevalence of arterial thrombosis in JAK2 mutated essential thrombocythaemia: independence of the V617F allele burden. 53 62
18616871 2008
32
Ratio of mutant JAK2-V617F to wild-type Jak2 determines the MPD phenotypes in transgenic mice. 53 62
18160670 2008
33
Clinical implications of JAK2 mutations in myeloproliferative disorders. 53 62
18575049 2008
34
Isolated thrombocytosis as first sign of chronic myeloid leukemia with e6a2 BCR/ABL fusion transcript, JAK2 negativity and complete response to imatinib. 53 62
17688946 2008
35
Thrombopoietin levels increased in patients with severe acute respiratory syndrome. 53 62
18314161 2008
36
Thrombopoietin is not uniquely responsible for thrombocytosis in inflammatory disorders. 53 62
18041648 2007
37
JAK2 mutations and clinical practice in myeloproliferative neoplasms. 53 62
18032973 2007
38
Phenotypic variations and new mutations in JAK2 V617F-negative polycythemia vera, erythrocytosis, and idiopathic myelofibrosis. 53 62
17920755 2007
39
Neonatal thrombocytosis following G-CSF treatment. 53 62
17917868 2007
40
Stem cell defects in Philadelphia chromosome negative chronic myeloproliferative disorders: a phenotypic and molecular puzzle? 53 62
18220909 2007
41
Essential versus reactive thrombocythemia in children: retrospective analyses of 12 cases. 53 62
17171694 2007
42
Diagnostic refinement of chronic myeloproliferative disorders and thrombocytoses of unknown origin by multiple RT-PCR and capillary electrophoresis of BCR-ABL rearrangements and JAK2 (V617F) mutation. 53 62
17285276 2007
43
Bortezomib is an effective agent for MDS/MPD syndrome with 5q- anomaly and thrombocytosis. 53 62
16820206 2007
44
[JAK2(V617F) mutation in Korean patients with essential thrombocythemia]. 53 62
18094555 2007
45
[Blood cytokine levels as a clinical laboratory test]. 53 62
17441472 2007
46
Characteristic changes in platelet-large cell ratio, lactate dehydrogenase and C-reactive protein in thrombocytosis-related diseases. 53 62
17622783 2007
47
JAK-2 mutations and their relevance to myeloproliferative disease. 53 62
17133099 2007
48
Molecular mimicry in the chronic myeloproliferative disorders: reciprocity between quantitative JAK2 V617F and Mpl expression. 53 62
16912229 2006
49
Diagnostic usefulness of the Janus kinase 2 mutation in non BCR/ABL myeloproliferative disorders. 53 62
17249502 2006
50
Thrombopoietin and interleukin-6 levels in Henoch-Schönlein purpura. 53 62
17164950 2006

Variations for Thrombocytosis

ClinVar genetic disease variations for Thrombocytosis:

5
# Gene Name Type Significance ClinVarId dbSNP ID Position
1 PCDHA10, PCDHA1, PCDHA2, PCDHA3, PCDHA4, PCDHA5, PCDHA6, PCDHA7, PCDHA8, PCDHA9, [email protected] NM_018900.4(PCDHA1):c.2394+67303_2394+69956del DEL Uncertain Significance
975862 GRCh37: 5:140235570-140238223
GRCh38: 5:140855985-140858638

Expression for Thrombocytosis

Search GEO for disease gene expression data for Thrombocytosis.

Pathways for Thrombocytosis

Pathways related to Thrombocytosis according to GeneCards Suite gene sharing:

(show all 41)
# Super pathways Score Top Affiliating Genes
1
Show member pathways
13.93 CRP CSF2 CSF3 F2 IL11 IL1B
2 13.74 PPBP KITLG JAK2 IL6 IL3 F3
3
Show member pathways
13.72 THPO PPBP LIF KITLG JAK2 IL6
4
Show member pathways
13.54 CSF2 CSF3 EPO F2 IL11 IL1B
5
Show member pathways
13.46 THPO PPBP MPL KITLG JAK2 IL6
6
Show member pathways
13.32 CSF2 CSF3 IL11 IL1B IL3 IL6
7
Show member pathways
13.27 LIF JAK2 IL6 IL3 IL1B IL11
8
Show member pathways
13.24 THPO SERPINC1 SELP PPBP MPL JAK2
9
Show member pathways
13.06 CSF2 CSF3 IL11 IL1B IL3 IL6
10
Show member pathways
12.99 THPO PPBP KITLG JAK2 IL6 IL3
11
Show member pathways
12.91 KITLG JAK2 IL6 IL3 EPO CSF3
12
Show member pathways
12.66 IL1B IL3 IL6 KITLG PPBP THPO
13 12.65 KITLG IL6 IL1B CSF3 CSF2
14
Show member pathways
12.56 THPO PPBP KITLG JAK2 IL6 IL3
15 12.53 MPL KITLG JAK2 IL3 IL1B
16
Show member pathways
12.38 JAK2 IL6 IL1B IL11
17
Show member pathways
12.34 THPO PPBP KITLG IL6 IL3
18
Show member pathways
12.23 JAK2 IL6 CSF3 CSF2
19 12.01 THPO LIF KITLG IL6 IL3 IL11
20 11.93 IL1B IL6 JAK2 LIF
21 11.88 THPO MPL JAK2 CRP
22
Show member pathways
11.85 JAK2 IL6 CSF3 CSF2
23
Show member pathways
11.82 JAK2 IL6 IL1B
24 11.75 JAK2 IL6 IL3
25
Show member pathways
11.75 JAK2 IL1B F3
26 11.71 IL6 IL1B CSF2
27 11.7 THPO PPBP KITLG IL6 IL3
28
Show member pathways
11.69 LIF JAK2 IL6 IL11
29
Show member pathways
11.68 CSF2 IL3 JAK2
30 11.67 JAK2 IL6 IL1B
31
Show member pathways
11.63 IL6 IL1B CSF2
32 11.62 JAK2 IL6 IL1B
33 11.62 IL6 IL1B CSF3 CSF2
34 11.46 JAK2 IL6 CRP
35 11.45 KITLG IL6 IL3 IL11 EPO
36 11.39 LIF IL6 IL1B CSF3 CSF2
37 11.34 THPO MPL KITLG IL6 IL3 IL11
38 10.98 JAK2 IL6 IL11
39 10.9 IL6 IL3 IL1B IL11 CSF3 CSF2
40 10.76 IL6 IL1B
41 10.76 THPO PPBP LIF KITLG IL6 IL3

GO Terms for Thrombocytosis

Cellular components related to Thrombocytosis according to GeneCards Suite gene sharing:

# Name GO ID Score Top Affiliating Genes
1 extracellular region GO:0005576 10.12 CRP CSF2 CSF3 EPO F2 F3
2 extracellular space GO:0005615 9.83 CRP CSF2 CSF3 EPO F2 F3
3 granulocyte macrophage colony-stimulating factor receptor complex GO:0030526 9.46 JAK2 CSF2

Biological processes related to Thrombocytosis according to GeneCards Suite gene sharing:

(show all 21)
# Name GO ID Score Top Affiliating Genes
1 immune response GO:0006955 10.21 PPBP LIF JAK2 IL6 IL3 IL1B
2 positive regulation of DNA-binding transcription factor activity GO:0051091 10.18 JAK2 IL6 IL1B CSF3
3 positive regulation of MAPK cascade GO:0043410 10.18 IL11 IL6 JAK2 LIF THPO
4 cell population proliferation GO:0008283 10.14 THPO LIF KITLG IL11 CSF2
5 positive regulation of peptidyl-serine phosphorylation GO:0033138 10.13 CSF3 IL11 IL6 LIF
6 positive regulation of phosphatidylinositol 3-kinase signaling GO:0014068 10.1 SELP JAK2 F2 CSF3
7 cytokine-mediated signaling pathway GO:0019221 10.1 CSF3 F3 IL1B IL6 JAK2 MPL
8 cellular response to lipopolysaccharide GO:0071222 10.1 THPO PPBP JAK2 IL6 IL1B CSF3
9 response to lipopolysaccharide GO:0032496 10.09 THPO SELP JAK2 IL1B EPO
10 embryo implantation GO:0007566 10.07 LIF IL1B EPO
11 positive regulation of T cell proliferation GO:0042102 10.06 KITLG JAK2 IL6 IL1B
12 positive regulation of receptor signaling pathway via JAK-STAT GO:0046427 10.04 F2 IL6 JAK2
13 acute-phase response GO:0006953 10.01 CRP EPO F2 IL6
14 positive regulation of tyrosine phosphorylation of STAT protein GO:0042531 9.93 CSF2 EPO IL3 IL6 JAK2 LIF
15 myeloid cell differentiation GO:0030099 9.91 TET2 JAK2 CSF2
16 positive regulation of leukocyte proliferation GO:0070665 9.9 JAK2 CSF2
17 thrombopoietin-mediated signaling pathway GO:0038163 9.88 THPO MPL
18 granulocyte-macrophage colony-stimulating factor signaling pathway GO:0038157 9.86 JAK2 CSF2
19 positive regulation of peptidyl-tyrosine phosphorylation GO:0050731 9.8 LIF KITLG JAK2 IL6 IL3 IL11
20 hemostasis GO:0007599 9.72 SERPINC1 F3 F2
21 positive regulation of cell population proliferation GO:0008284 9.72 CSF2 CSF3 EPO F2 IL11 IL1B

Molecular functions related to Thrombocytosis according to GeneCards Suite gene sharing:

# Name GO ID Score Top Affiliating Genes
1 growth factor activity GO:0008083 9.96 CSF2 CSF3 F2 IL11 IL3 IL6
2 signaling receptor binding GO:0005102 9.85 THPO LIF JAK2 IL6 F2 CSF3
3 cytokine activity GO:0005125 9.64 THPO PPBP LIF KITLG IL6 IL3

Sources for Thrombocytosis

2 CDC
6 CNVD
8 Cosmic
9 dbSNP
10 DGIdb
16 EFO
17 ExPASy
18 FMA
19 GARD
27 GO
28 GTR
29 HMDB
30 HPO
31 ICD10
32 ICD10 via Orphanet
33 ICD11
34 ICD9CM
35 IUPHAR
36 LifeMap
38 LOVD
40 MedGen
43 MeSH
44 MESH via Orphanet
45 MGI
48 NCI
49 NCIt
50 NDF-RT
52 NINDS
53 Novoseek
55 ODiseA
56 OMIM via Orphanet
57 OMIM® (Updated 08-Dec-2022)
61 PubChem
62 PubMed
64 QIAGEN
69 SNOMED-CT via HPO
70 Tocris
71 UMLS
72 UMLS via Orphanet
Content
Loading form....