Thrombocytosis disease: Malacards - Research Articles, Drugs, Genes, Clinical Trials

MCID: THR004 MIFTS: 53	Thrombocytosis Categories: Blood diseases	Data Licensing For inquiries, contact: [email protected]
Genes Variations Tissues Related diseases Publications Drugs Expand all tables

Sources

Aliases & Classifications for Thrombocytosis

MalaCards integrated aliases for Thrombocytosis:

Name: Thrombocytosis ¹¹ ⁷⁵ ²⁸ ⁵³ ⁵ ⁴³ ¹⁴ ⁷¹ ⁷⁵ ³³

Thrombocythaemia ¹¹

Classifications:

MalaCards categories:
Anatomical: Blood diseases

See all MalaCards categories (disease lists)

ICD11: ³³

Diseases of the blood or blood-forming organs

Coagulation defects, purpura or other haemorrhagic or related conditions

Thrombocytosis

Other specified thrombocytosis

Thrombocytosis, unspecified

External Ids:

Disease Ontology ¹¹ DOID:2228

MeSH ⁴³ D013922

NCIt ⁴⁹ C35530

SNOMED-CT ⁶⁸ 165557006

ICD11 ³³ 11621191 11621191/other 11621191/unspecified

UMLS ⁷¹ C0836924

Sources

Summaries for Thrombocytosis

Disease Ontology: ¹¹ A blood platelet disease that is characterized by the presence of high platelet counts in the blood.

MalaCards based summary: Thrombocytosis, also known as thrombocythaemia, is related to refractory anemia and transient erythroblastopenia of childhood. An important gene associated with Thrombocytosis is JAK2 (Janus Kinase 2), and among its related pathways/superpathways are Innate Immune System and Signal Transduction. The drugs Benzocaine and Tannic acid have been mentioned in the context of this disorder. Affiliated tissues include myeloid, bone marrow and liver, and related phenotypes are homeostasis/metabolism and immune system

Wikipedia: ⁷⁵ Thrombocythemia is a condition of high platelet (thrombocyte) count in the blood. Normal count is in the... more...

Sources

Related Diseases for Thrombocytosis

Diseases related to Thrombocytosis via text searches within MalaCards or GeneCards Suite gene sharing:

(show top 50) (show all 1000)

#	Related Disease	Score	Top Affiliating Genes
1	refractory anemia	32.2	TET2 MPL EPO CSF3
2	transient erythroblastopenia of childhood	32.1	KITLG EPO
3	poems syndrome	31.9	IL6 IL1B EPO CSF3
4	essential thrombocythemia	31.7	THPO TET2 SELP PPBP MPL KITLG
5	splenomegaly	31.2	MPL JAK2 EPO
6	iron deficiency anemia	31.1	THPO IL6 IL11 EPO CRP
7	myelodysplastic/myeloproliferative neoplasm	31.0	TET2 JAK2 CSF2
8	myeloid leukemia	30.7	TET2 LIF KITLG JAK2 IL3 CSF3
9	paraneoplastic syndromes	30.7	IL6 CSF3
10	temporal arteritis	30.6	JAK2 IL6 IL1B CSF2 CRP
11	neutrophilia, hereditary	30.6	JAK2 IL6 IL3 CSF3 CSF2 CRP
12	thrombophilia due to thrombin defect	30.6	SERPINC1 SELP F3 F2
13	thrombocytopenia due to platelet alloimmunization	30.5	THPO SELP MPL F3
14	bowel dysfunction	30.5	IL6 IL1B CRP
15	portal hypertension	30.5	THPO JAK2 F2
16	granulocytopenia	30.5	IL3 CSF3 CSF2
17	acquired von willebrand syndrome	30.5	JAK2 F3 F2
18	crohn's disease	30.5	IL6 IL1B CSF2 CRP
19	coronary thrombosis	30.5	SERPINC1 F3 CRP
20	myelofibrosis	30.5	THPO TET2 SELP MPL JAK2 IL3
21	leukemia	30.5	THPO MPL LIF JAK2 IL3 CSF2
22	chronic eosinophilic pneumonia	30.4	IL6 CSF3 CSF2
23	pulmonary embolism	30.4	SERPINC1 F3 F2 CRP
24	myeloproliferative neoplasm	30.4	THPO TET2 SELP PPBP MPL KITLG
25	pneumonia	30.4	IL6 IL1B CSF3 CSF2 CRP
26	factor viii deficiency	30.4	SERPINC1 F3 F2
27	pain agnosia	30.4	IL6 IL1B CRP
28	amegakaryocytic thrombocytopenia, congenital	30.4	THPO MPL JAK2 IL3
29	celiac disease 1	30.4	IL6 IL1B CSF2 CRP
30	pleural empyema	30.3	IL6 F2 CRP
31	osteomyelitis	30.3	IL6 IL1B CSF3 CRP
32	urinary tract infection	30.3	IL6 IL1B F3 F2 CRP
33	acute megakaryocytic leukemia	30.3	THPO MPL JAK2 IL3 IL11 CSF2
34	budd-chiari syndrome	30.3	SERPINC1 MPL JAK2 F3 F2
35	alcohol use disorder	30.3	IL6 IL1B F2 CRP
36	bronchiolitis	30.3	IL6 IL1B IL11 CSF2 CRP
37	stress polycythemia	30.3	JAK2 EPO
38	polycythemia	30.3	THPO TET2 PPBP MPL KITLG JAK2
39	angina pectoris	30.3	IL6 F3 CRP
40	bacterial meningitis	30.3	IL1B CSF3 CRP
41	spondylitis	30.3	IL6 IL1B CRP
42	acute leukemia	30.2	THPO MPL KITLG JAK2 IL3 EPO
43	osteosclerotic myeloma	30.2	IL6 IL1B
44	thyroiditis	30.2	IL6 IL1B CRP
45	thrombosis	30.2	SERPINC1 SELP PPBP MPL JAK2 F3
46	anemia, autoimmune hemolytic	30.2	IL6 EPO CRP
47	vasculitis	30.2	SELP IL6 IL1B CRP
48	pyuria	30.2	IL6 F2 CRP
49	myelodysplastic syndrome	30.2	THPO TET2 MPL KITLG JAK2 IL6
50	thrombocytopenic purpura, autoimmune	30.2	THPO SELP MPL IL11 F3 F2

Graphical network of the top 20 diseases related to Thrombocytosis:

Sources

Symptoms & Phenotypes for Thrombocytosis

MGI Mouse Phenotypes related to Thrombocytosis:

⁴⁵ (show all 11)

#	Description	MGI Source Accession	Score	Top Affiliating Genes
1	homeostasis/metabolism	MP:0005376	10.36	CRP CSF2 EPO F2 F3 IL1B
2	immune system	MP:0005387	10.32	CRP CSF2 CSF3 EPO F2 F3
3	cellular	MP:0005384	10.28	CSF2 EPO F2 F3 IL3 IL6
4	cardiovascular system	MP:0005385	10.22	CRP CSF2 EPO F2 F3 IL1B
5	neoplasm	MP:0002006	10.1	CSF2 F3 IL1B IL3 IL6 JAK2
6	hematopoietic system	MP:0005397	10.09	CSF2 CSF3 EPO F2 F3 IL1B
7	liver/biliary system	MP:0005370	10.08	EPO IL6 JAK2 KITLG LIF SELP
8	respiratory system	MP:0005388	10.02	CSF2 EPO F2 F3 IL3 IL6
9	skeleton	MP:0005390	9.96	CSF2 F2 IL1B IL3 IL6 JAK2
10	mortality/aging	MP:0010768	9.8	CSF2 EPO F2 F3 IL1B IL3
11	integument	MP:0010771	9.32	CSF2 CSF3 F2 F3 IL1B IL6

Sources

Drugs & Therapeutics for Thrombocytosis

Drugs for Thrombocytosis (from DrugBank, HMDB, Dgidb, PharmGKB, IUPHAR, NovoSeek, BitterDB):

(show top 50) (show all 232)

Name

Status

Phase

Clinical Trials

Cas Number

PubChem Id

Benzocaine

Approved, Investigational

Phase 4

1994-09-7, 94-09-7

2337

Tannic acid

Approved

Phase 4

1401-55-4

16129878 16129778

Peginterferon alfa-2b

Approved

Phase 4

215647-85-1, 99210-65-8

Anti-Infective Agents

Phase 4

Antiviral Agents

Phase 4

Interferon alpha-2

Phase 4

Interferon-alpha

Phase 4

Anagrelide

Approved

Phase 3

68475-42-3

2182 135409400

Hydroxyurea

Approved

Phase 3

127-07-1

3657

Peginterferon alfa-2a

Approved, Investigational

Phase 3

198153-51-4

Apixaban

Approved

Phase 3

503612-47-3

10182969

Acetylsalicylic acid

Approved, Vet_approved

Phase 3

50-78-2

2244

Sodium citrate

Approved, Investigational

Phase 3

68-04-2

23431961

Rivaroxaban

Approved

Phase 3

366789-02-8

9875401

Iron

Approved

Phase 3

7439-89-6

29936

Danazol

Approved

Phase 3

17230-88-5

28417

Lactitol

Approved, Investigational

Phase 2, Phase 3

585-86-4

157355

Citric acid

Approved, Nutraceutical, Vet_approved

Phase 3

77-92-9

311

Fibrinolytic Agents

Phase 3

Platelet Aggregation Inhibitors

Phase 3

Mitogens

Phase 3

interferons

Phase 3

Antirheumatic Agents

Phase 3

Cyclooxygenase Inhibitors

Phase 3

Anti-Inflammatory Agents, Non-Steroidal

Phase 3

Androgens

Phase 2, Phase 3

Analgesics, Non-Narcotic

Phase 3

Anti-Inflammatory Agents

Phase 3

Analgesics

Phase 3

Antipyretics

Phase 3

Anticoagulants

Phase 3

Citrate

Phase 3

Hormones

Phase 3

Hormone Antagonists

Phase 3

Estrogens

Phase 3

Estrogen Receptor Antagonists

Phase 3

Estrogen Antagonists

Phase 3

Hepcidins

Phase 3

Janus Kinase Inhibitors

Phase 3

Levoleucovorin

Approved, Experimental, Investigational

Phase 2

68538-85-2, 58-05-9, 73951-54-9

149436 6006

Pembrolizumab

Approved

Phase 2

1374853-91-4

254741536

Miconazole

Approved, Investigational, Vet_approved

Phase 2

22916-47-8

4189

Clotrimazole

Approved, Vet_approved

Phase 2

23593-75-1

2812

Lenograstim

Approved, Investigational

Phase 2

135968-09-1

Methotrexate

Approved

Phase 2

1959-05-2, 59-05-2

4112 126941

Aldesleukin

Approved

Phase 1, Phase 2

110942-02-4

Lenalidomide

Approved

Phase 2

191732-72-6

216326

Prednisone

Approved, Vet_approved

Phase 2

53-03-2

5865

Pomalidomide

Approved

Phase 2

19171-19-8

134780

Thalidomide

Approved, Investigational, Withdrawn

Phase 2

50-35-1

5426

Interventional clinical trials:

(show top 50) (show all 181)

#	Name	Status	NCT ID	Phase	Drugs
1	A Multicenter, Open-label, Clinical Study for Efficacy and Safety Evaluation of Anagrelide in Patients With Treatment-naïve, High-risk Essential Thrombocythemia as a Primary Treatment	Completed	NCT03232177	Phase 4	Anagre Cap.
2	A Phase IIIb, Randomized, Open Label Study to Compare the Safety, Efficacy and Tolerability of Anagrelide Hydrochloride Versus Hydroxyurea in High-Risk Essential Thrombocythaemia Patients.	Completed	NCT00202644	Phase 4	Anagrelide;Hydroxyurea
3	A UK Open-label, Multicentre, Exploratory Phase II Study of INC424 for Patients With Primary Myelofibrosis (PMF) or Post Polycythaemia Myelofibrosis (PPV MF) or Post Essential Thrombocythaemia Myelofibrosis (PET-MF)	Completed	NCT01558739	Phase 4	INC424
4	A Prospective, Single-center Clinical Trial of Pegylated Interferon Alfa-2b Versus Interferon Alfa Therapy in the Treatment of Childhood and Adolescent Essential Thrombocythemia	Recruiting	NCT04226950	Phase 4	Recombinant Interferon Alpha;Pegylated interferon alfa-2b
5	A Prospective, Multicenter, Randomized Controlled Clinical Trial of Pegylated Interferon Alfa-2b Versus Interferon Alfa Therapy in the Treatment of Adult Essential Thrombocythemia	Recruiting	NCT05395507	Phase 4	Recombinant Interferon Alpha;Pegylated interferon alfa-2b
6	French Aspirin Study in Essential Thrombocythemia: an Open and Randomized Study	Unknown status	NCT02611973	Phase 3	Hydroxyurea treatment (HU)
7	A Phase 3, Randomized Study To Evaluate the Efficacy of Momelotinib Versus Best Available Therapy in Anemic or Thrombocytopenic Subjects With Primary Myelofibrosis, Post-polycythemia Vera Myelofibrosis, or Post-essential Thrombocythemia Myelofibrosis Who Were Treated With Ruxolitinib	Completed	NCT02101268	Phase 3	Momelotinib;Best Available Therapy (BAT)
8	A Multicenter, Open-label Clinical Study of the JAK Inhibitor Ruxolitinib (INC424) in Patients With Primary Myelofibrosis, Post-polycythemia Vera Myelofibrosis, or Post-essential Thrombocythemia Myelofibrosis	Completed	NCT02087059	Phase 3	Ruxolitinib
9	A Phase III Randomized, Multicenter, Double-blind, Active Controlled Study to Compare the Efficacy and Safety of Two Different Anagrelide Formulations in Patients With Essential Thrombocythemia (TEAM-ET 2.0)	Completed	NCT02076815	Phase 3	Anagrelide retard;Thromboreductin
10	A Phase 3, Randomized, Double-blind Active-controlled Study Evaluating Momelotinib vs. Ruxolitinib in Subjects With Primary Myelofibrosis (PMF) or Post-Polycythemia Vera or Post-Essential Thrombocythemia Myelofibrosis (Post-PV/ET MF)	Completed	NCT01969838	Phase 3	Momelotinib;Ruxolitinib;Placebo to match momelotinib;Placebo to match ruxolitinib
11	A Single Blind, Multi-centre, Randomised Multinational Phase III Study to Compare the Efficacy and Tolerability of Anagrelide vs Hydroxyurea in Patients With Essential Thrombocythaemia	Completed	NCT01065038	Phase 3	Anagrelide;Hydroxyurea
12	Randomized Trial of Pegylated Interferon Alfa-2a Versus Hydroxyurea Therapy in the Treatment of High Risk Polycythemia Vera (PV) and High Risk Essential Thrombocythemia (ET)	Completed	NCT01259856	Phase 3	PEGASYS;Hydroxyurea;Aspirin
13	A Phase III, Randomized, Multicenter, Subject and Sponsor-blinded, Placebo Controlled Study to Compare the Efficacy and Safety of "Anagrelide Retard" Versus Placebo in "at Risk" Subjects With Essential Thrombocythaemia	Completed	NCT01230775	Phase 3	Anagrelide retard;Placebo
14	An Open-label, Multicenter, Expanded Access Study of INC424 for Patients With Primary Myelofibrosis (PMF) or Post Polycythemia Myelofibrosis (PPV MF) or Post-essential Thrombocythemia Myelofibrosis (PET-MF).	Completed	NCT01493414	Phase 3	INC424
15	A Phase 3, Multi-centre, Open-label, Extension Study to Investigate the Long-term Safety of SPD422 in Japanese Adults With Essential Thrombocythaemia	Completed	NCT01467661	Phase 3	SPD422 (anagrelide hydrochloride)
16	A Phase 3, Open-label, Single-arm Study Evaluating the Effect of SPD422 on Platelet Lowering and Safety in Japanese Adults With At Risk Essential Thrombocythaemia Who Are Intolerant or Refractory to Current Cytoreductive Treatment	Completed	NCT01214915	Phase 3	Anagrelide Hydrochloride
17	Danish Study of Low-dose Interferon Alpha Versus Hydroxyurea in the Treatment of Philadelphia Chromosome Negative (Ph-)Chronic Myeloid Neoplasms.	Completed	NCT01387763	Phase 3	PegIntron;Pegasys;Hydrea
18	A Phase 3, Open-Label, Multicenter, Randomized, Active-controlled Study to Assess Pharmacokinetics and Compare the Efficacy, Safety, and Tolerability of P1101 vs Anagrelide as Second Line Therapy for Essential Thrombocythemia	Recruiting	NCT04285086	Phase 3	Anagrelide
19	A Randomized, Double-Blind, Placebo-Controlled Study of the PI3Kδ Inhibitor Parsaclisib Plus Ruxolitinib in Participants With Myelofibrosis Who Have Suboptimal Response to Ruxolitinib	Recruiting	NCT04551053	Phase 3	parsaclisib;ruxolitinib;placebo
20	A Phase 3, Randomized, Double-blind, Active-Control Study of Pelabresib (CPI-0610) and Ruxolitinib vs. Placebo and Ruxolitinib in JAKi Treatment Naive MF Patients	Recruiting	NCT04603495	Phase 3	Pelabresib;Ruxolitinib;Placebo
21	A Phase 3, Randomized, Double-Blind, Placebo-Controlled Study of the Combination of PI3Kδ Inhibitor Parsaclisib and Ruxolitinib in Participants With Myelofibrosis	Recruiting	NCT04551066	Phase 3	parsaclisib;ruxolitinib;placebo
22	A Phase 2/3 Randomized, Controlled, Open-Label Study of KRT 232 in Subjects With Primary Myelofibrosis (PMF), Post Polycythemia Vera MF (Post-PV-MF), Or Post Essential Thrombocythemia MF (Post-ET-MF) Who Are Relapsed or Refractory to Janus Kinase (JAK) Inhibitor Treatment	Recruiting	NCT03662126	Phase 2, Phase 3	KRT-232;Best Available Therapy (BAT)
23	A Randomized, Controlled Phase 3 Study of Pacritinib Versus Physician's Choice in Patients With Primary Myelofibrosis, Post Polycythemia Vera Myelofibrosis, or Post-Essential Thrombocythemia Myelofibrosis With Severe Thrombocytopenia (Platelet Count <50,000/μL)(PACIFICA)	Recruiting	NCT03165734	Phase 3	Pacritinib;Physician's Choice medications
24	AVAJAK: Apixaban/Rivaroxaban Versus Aspirin for Primary Prevention of Thrombo-embolic Complications in JAK2V617F-positive Myeloproliferative Neoplasms	Recruiting	NCT05198960	Phase 3	Direct Oral Anticoagulants;Low-dose aspirin
25	A Phase 3, Multicenter, Open-label, Randomized Study to Evaluate the Efficacy and Safety of Fedratinib Compared to Best Available Therapy (BAT) in Subjects With DIPSS (Dynamic International Prognostic Scoring System)-Intermediate or High-risk Primary Myelofibrosis (PMF), Post-polycythemia Vera Myelofibrosis (Post-PV MF), or Post-essential Thrombocythemia Myelofibrosis (Post-ET MF) and Previously Treated With Ruxolitinib	Recruiting	NCT03952039	Phase 3	FEDRATINIB;Best Available Therapy (BAT)
26	A Phase 3b, Multicenter, Single-Arm, Open-Label Efficacy and Safety Study of Fedratinib in Subjects With DIPSS (Dynamic International Prognostic Scoring System)-Intermediate or High-Risk Primary Myelofibrosis (PMF), Post-Polycythemia Vera Myelofibrosis (Post-PV MF), or Post-Essential Thrombocythemia Myelofibrosis (Post-ET MF) and Previously Treated With Ruxolitinib	Active, not recruiting	NCT03755518	Phase 3	FEDRATINIB
27	A Randomized, Double-blind, Phase 3 Study to Evaluate the Activity of Momelotinib (MMB) Versus Danazol (DAN) in Symptomatic, Anemic Subjects With Primary Myelofibrosis (PMF), Post-polycythemia Vera (PV) Myelofibrosis, or Post-essential Thrombocythemia (ET) Myelofibrosis Who Were Previously Treated With JAK Inhibitor Therapy	Active, not recruiting	NCT04173494	Phase 3	Momelotinib;Danazol;Placebo to match momelotinib;Placebo to match danazol
28	A Randomized, Multicenter Phase IIb Study to Evaluate the Efficacy and Safety of Ruxolitinib Versus Best Available Therapy in Patients With High Risk Essential Thrombocythemia, Who Are Resistant or Intolerant to Hydroxyurea: A FIM Study	Terminated	NCT02962388	Phase 2, Phase 3	Anagrelide;Ruxolitinib (JAKAVI®);IFNα/ PegIFNα
29	A Randomized Controlled Phase 3 Study of Oral Pacritinib Versus Best Available Therapy in Patients With Thrombocytopenia and Primary Myelofibrosis, Post-Polycythemia Vera Myelofibrosis, or Post-Essential Thrombocythemia Myelofibrosis	Terminated	NCT02055781	Phase 3	Pacritinib;Best Available Therapy
30	A Randomized Controlled Phase 3 Study of Oral Pacritinib Versus Best Available Therapy in Patients With Primary Myelofibrosis, Post-Polycythemia Vera Myelofibrosis, or Post-Essential Thrombocythemia Myelofibrosis	Terminated	NCT01773187	Phase 3	Pacritinib;Best Available Therapy
31	A Multicenter, Open Label Phase I/II Study of CEP-701 (Lestaurtinib) in Adults With Myelofibrosis	Unknown status	NCT00668421	Phase 1, Phase 2	CEP-701 (Lestaurtinib)
32	A Phase II Study of MK-0683 in Patients With Polycythaemia Vera and Essential Thrombocythaemia.	Unknown status	NCT00866762	Phase 2	HDAC inhibitor (MK-0683)
33	Dual Vaccine Trial in Myeloproliferative Neoplasms	Unknown status	NCT04051307	Phase 1, Phase 2	PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL;Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
34	A Phase I/II Open Label Study of LBH589, a Novel Histone Deacetylase Inhibitor (HDACi), in Patients With Primary Myelofibrosis (PMF) and Post-polycythemia/Essential Thrombocythemia Myelofibrosis (Post-PV/ET MF)	Unknown status	NCT01298934	Phase 1, Phase 2	LBH589
35	A Phase 2, Open Label Efficacy and Safety Study of Anagrelide Controlled Release (CR) in Subjects With Thrombocytosis Secondary to Essential Thrombocythemia and Other Myeloproliferative Neoplasms (MPN)	Completed	NCT02125318	Phase 2	Anagrelide CR
36	Open Label Phase 2 Single Agent Study of LCL-161 in Patients With Primary Myelofibrosis (PMF), Post-Polycythemia Vera Myelofibrosis (Post-PV MF), or Post-Essential Thrombocytosis Myelofibrosis (Post-ET MF)	Completed	NCT02098161	Phase 2	Smac Mimetic LCL161
37	An Open-Label Study of Oral CEP-701 in Patients With Polycythemia Vera or Essential Thrombocytosis With the JAK2 V617F Mutation	Completed	NCT00586651	Phase 2	lestaurtinib
38	A Phase 1/2, Open-Label Study of the JAK2 Inhibitor INCB018424 Administered Orally to Patients With Primary Myelofibrosis (PMF) and Post Polycythemia Vera/Essential Thrombocythemia Myelofibrosis (Post-PV/ET)	Completed	NCT00509899	Phase 1, Phase 2	Ruxolitinib
39	A Phase Ib/II, Open-label, Multi-center, Dose-finding Study to Assess the Safety and Efficacy of the Oral Combination of LDE225 and INC424 (Ruxolitinib) in Patients With Myelofibrosis	Completed	NCT01787552	Phase 1, Phase 2	LDE225;INC424
40	Phase II Study of Shortened-duration Tacrolimus Following Nonmyeloablative Peripheral Blood Stem Cell Transplant With High-dose Posttransplantation Cyclophosphamide in Malignancies That Are Challenging to Engraft	Completed	NCT02556931	Phase 2	Fludarabine;Cyclophosphamide;Tacrolimus;Mycophenolate mofetil
41	A Phase 2, Prospective Study Of PRM-151 In Subjects With Primary Myelofibrosis (PMF), Post-Polycythemia Vera MF (Post-PV MF), Or Post-Essential Thrombocythemia MF (Post-ET MF)	Completed	NCT01981850	Phase 2	Ruxolitinib
42	A Phase 2 Open-Label, Dose-Ranging Study of the Efficacy and Safety of Orally Administered SAR302503 in Japanese Patients With Intermediate-2 or High Risk Primary Myelofibrosis, Post-Polycythemia Vera Myelofibrosis, Post-Essential Thrombocythemia Myelofibrosis With Splenomegaly	Completed	NCT01692366	Phase 2	SAR302503
43	A Phase II, Open-label, Multicentre, Pharmacokinetic, Pharmacodynamic and Safety Study of Anagrelide Hydrochloride in Young (18-50 Years) and Elderly (≥ 65 Years) Patients With Essential Thrombocythaemia.	Completed	NCT00413634	Phase 2	anagrelide hydrochloride
44	Low-Dose TBI Dose Escalation to Decrease Risks of Progression and Graft Rejection After Hematopoietic Cell Transplantation With Nonmyeloablative Conditioning as Treatment for Untreated Myelodysplastic Syndrome or Myeloproliferative Disorders - A Multi-Center Trial	Completed	NCT00397813	Phase 2	Cyclosporine;Fludarabine Phosphate;Mycophenolate Mofetil
45	A Phase II Study to Evaluate the Efficacy of Oral Beclomethasone Dipropionate for Prevention of Acute GVHD After Hematopoietic Cell Transplantation With Myeloablative Conditioning Regimens	Completed	NCT00489203	Phase 2	beclomethasone dipropionate;placebo;tacrolimus;methotrexate
46	PD-1 Inhibition in Advanced Myeloproliferative Neoplasms	Completed	NCT03065400	Phase 2	Pembrolizumab
47	A Multicenter Phase II, Open Label, Single Arm Study to Evaluate the Efficacy and Safety of Ruxolitinib in the Treatment of Anemic Myelofibrosis Patients.	Completed	NCT02966353	Phase 2	ruxolitinib
48	A Phase 1/2 Study of Oral SB1518 in Subjects With Chronic Idiopathic Myelofibrosis	Completed	NCT00745550	Phase 1, Phase 2	SB1518
49	Open-label Study to Assess the Long-term Safety and Efficacy of Momelotinib in Subjects With Primary Myelofibrosis, Post-polycythemia Vera Myelofibrosis, Post Essential Thrombocythemia Myelofibrosis, Polycythemia Vera or Essential Thrombocythemia	Completed	NCT02124746	Phase 2	Momelotinib
50	Phase II Trial of Triapine (NSC #663249, 3-Aminopyridine-2-Carboxaldehyde Thiosemicarbone) Plus Fludarabine (NSC #312887, Fludarabine Monophosphate) in Adults With Aggressive Myeloproliferative Disorders (MPDs) Including Chronic Myelomonocytic Leukemia (CMML) and Chronic Myelogenous Leukemia in Accelerated Phase (CML-AP) or Blast Crisis (CML-BC)	Completed	NCT00381550	Phase 2	fludarabine phosphate;triapine

Search NIH Clinical Center for Thrombocytosis

Inferred drug relations via UMLS ⁷¹ / NDF-RT ⁵⁰ :

Chlorambucil

Uracil Mustard

Cochrane evidence based reviews: thrombocytosis

Sources

Genetic Tests for Thrombocytosis

Genetic tests related to Thrombocytosis:

#	Genetic test	Affiliating Genes
1	Thrombocytosis ²⁸

Sources

Anatomical Context for Thrombocytosis

Organs/tissues related to Thrombocytosis:

MalaCards : Myeloid, Bone Marrow, Liver, Bone, Endothelial, Neutrophil, Lung

Sources

Publications for Thrombocytosis

Articles related to Thrombocytosis:

(show top 50) (show all 5626)

#	Title	Authors	PMID	Year
1	Clinical utility of routine MPL exon 10 analysis in the diagnosis of essential thrombocythaemia and primary myelofibrosis. ⁵³ ⁶²	Boyd EM...Erber WN	20151976	2010
2	Conditional expression of heterozygous or homozygous Jak2V617F from its endogenous promoter induces a polycythemia vera-like disease. ⁵³ ⁶²	Akada H...Mohi MG	20197548	2010
3	Efficacy of the JAK2 inhibitor INCB16562 in a murine model of MPLW515L-induced thrombocytosis and myelofibrosis. ⁵³ ⁶²	Koppikar P...Levine RL	20154217	2010
4	JAK2 and MPL gene mutations in V617F-negative myeloproliferative neoplasms. ⁵³ ⁶²	Siemiatkowska A...Limon J	19643476	2010
5	Narrative review: Thrombocytosis, polycythemia vera, and JAK2 mutations: The phenotypic mimicry of chronic myeloproliferation. ⁵³ ⁶²	Spivak JL	20194236	2010
6	Mutations of JAK2 and TET2, but not CBL are detectable in a high portion of patients with refractory anemia with ring sideroblasts and thrombocytosis. ⁵³ ⁶²	Flach J...Haferlach C	19903679	2010
7	Class prediction models of thrombocytosis using genetic biomarkers. ⁵³ ⁶²	Gnatenko DV...Bahou WF	19773543	2010
8	[Diabetes insipidus followed, after 4 years, with dysarthria and mild right-sided hemiparesis--the first clinical signs of Erdheim-Chester disease. Description and depiction of a case with a review of information on the disease]. ⁵³ ⁶²	Adam Z...Mayer J	20070034	2009
9	[Paediatric myofibroblastic tumours. A presentation of three cases]. ⁵³ ⁶²	Lizarbe MO...Garicano JM	19647502	2009
10	JAK2 V617F mutation and PRV-1 overexpression: relevance in the diagnosis of polycythaemia vera and essential thrombocythaemia. ⁵³ ⁶²	Melis S...De Schouwer PJ	19999391	2009
11	Comparison of JAK2V617F mutation assessment employing different molecular diagnostic techniques. ⁵³ ⁶²	Veneri D...Pizzolo G	19657484	2009
12	Granulocytosis and thrombocytosis in renal cell carcinoma: a pro-inflammatory cytokine response originating in the tumour. ⁵³ ⁶²	van Rossum AP...Castel A	19581670	2009
13	Thrombocytosis in EPO-treated dialysis patients may be mediated by EPO rather than iron deficiency. ⁵³ ⁶²	Vaziri ND	19303685	2009
14	A case of acute promyelocytic leukemia showing transient thrombocytosis caused by increased interleukin-6 and thrombopoietin after treatment with all-trans retinoic acid and chemotherapy. ⁵³ ⁶²	Kondo M...Shinohara K	19461187	2009
15	Mutational inhibition of c-Myb or p300 ameliorates treatment-induced thrombocytopenia. ⁵³ ⁶²	Hilton DJ...Alexander WS	19252138	2009
16	The production of JAK2 wild-type platelets is not downregulated in patients with JAK2 V617F mutant-positive essential thrombocythaemia. ⁵³ ⁶²	Lambert JR...Linch DC	19222478	2009
17	[A case of IL-6 producing malignant mesothelioma of abdomen with thrombocytosis]. ⁵³ ⁶²	Fukuyama T...Nojima T	19346724	2009
18	Incomplete restoration of Mpl expression in the mpl-/- mouse produces partial correction of the stem cell-repopulating defect and paradoxical thrombocytosis. ⁵³ ⁶²	Lannutti BJ...Josephson NC	18796624	2009
19	Pronounced thrombocytosis in transgenic mice expressing reduced levels of Mpl in platelets and terminally differentiated megakaryocytes. ⁵³ ⁶²	Tiedt R...Skoda RC	18845793	2009
20	Recurrent refractory arterial thromboembolism associated with the Janus kinase 2 V617F mutation. ⁵³ ⁶²	Ali FR...Arya R	19174256	2009
21	General changes in hemostasis in gastric cancer. ⁵³ ⁶²	Kovacova E...Remkova A	19507648	2009
22	Mice overexpressing murine oncostatin M (OSM) exhibit changes in hematopoietic and other organs that are distinct from those of mice overexpressing human OSM or bovine OSM. ⁵³ ⁶²	Juan TS...Fletcher FA	19112126	2009
23	Familial thrombocytosis caused by the novel germ-line mutation p.Pro106Leu in the MPL gene. ⁵³ ⁶²	El-Harith el-HA...Stuhrmann M	19036112	2009
24	Thrombocytosis. ⁵³ ⁶²	Skoda RC	20008195	2009
25	Anagrelide: 20 years later. ⁵³ ⁶²	Emadi A...Spivak JL	19105705	2009
26	Erythropoietin, iron depletion, and relative thrombocytosis: a possible explanation for hemoglobin-survival paradox in hemodialysis. ⁵³ ⁶²	Streja E...Kalantar-Zadeh K	18760517	2008
27	Familial chronic myeloproliferative disorders: the state of the art. ⁵³ ⁶²	Rumi E	18484677	2008
28	A de novo splice donor mutation in the thrombopoietin gene causes hereditary thrombocythemia in a Polish family. ⁵³ ⁶²	Liu K...Skoda RC	18367486	2008
29	Thrombosis with erythropoietic stimulating agents-does iron-deficient erythropoiesis play a role? ⁵³ ⁶²	Dahl NV...Coyne DW	18397204	2008
30	Incidence and clinical significance of left ventricular thrombus in tako-tsubo cardiomyopathy assessed with echocardiography. ⁵³ ⁶²	Haghi D...Suselbeck T	18334499	2008
31	High prevalence of arterial thrombosis in JAK2 mutated essential thrombocythaemia: independence of the V617F allele burden. ⁵³ ⁶²	Larsen TS...Hasselbalch HC	18616871	2008
32	Ratio of mutant JAK2-V617F to wild-type Jak2 determines the MPD phenotypes in transgenic mice. ⁵³ ⁶²	Tiedt R...Skoda RC	18160670	2008
33	Clinical implications of JAK2 mutations in myeloproliferative disorders. ⁵³ ⁶²	Knoops L...Constantinescu SN	18575049	2008
34	Isolated thrombocytosis as first sign of chronic myeloid leukemia with e6a2 BCR/ABL fusion transcript, JAK2 negativity and complete response to imatinib. ⁵³ ⁶²	Breccia M...Alimena G	17688946	2008
35	Thrombopoietin levels increased in patients with severe acute respiratory syndrome. ⁵³ ⁶²	Yang M...Chong BH	18314161	2008
36	Thrombopoietin is not uniquely responsible for thrombocytosis in inflammatory disorders. ⁵³ ⁶²	Ceresa IF...Balduini CL	18041648	2007
37	JAK2 mutations and clinical practice in myeloproliferative neoplasms. ⁵³ ⁶²	Tefferi A	18032973	2007
38	Phenotypic variations and new mutations in JAK2 V617F-negative polycythemia vera, erythrocytosis, and idiopathic myelofibrosis. ⁵³ ⁶²	Williams DM...Moliterno AR	17920755	2007
39	Neonatal thrombocytosis following G-CSF treatment. ⁵³ ⁶²	Osovsky M...Merlob P	17917868	2007
40	Stem cell defects in Philadelphia chromosome negative chronic myeloproliferative disorders: a phenotypic and molecular puzzle? ⁵³ ⁶²	Bock O...Kreipe H	18220909	2007
41	Essential versus reactive thrombocythemia in children: retrospective analyses of 12 cases. ⁵³ ⁶²	El-Moneim AA...Niemeyer CM	17171694	2007
42	Diagnostic refinement of chronic myeloproliferative disorders and thrombocytoses of unknown origin by multiple RT-PCR and capillary electrophoresis of BCR-ABL rearrangements and JAK2 (V617F) mutation. ⁵³ ⁶²	Ammatuna E...Lo-Coco F	17285276	2007
43	Bortezomib is an effective agent for MDS/MPD syndrome with 5q- anomaly and thrombocytosis. ⁵³ ⁶²	Terpos E...Zervas K	16820206	2007
44	[JAK2(V617F) mutation in Korean patients with essential thrombocythemia]. ⁵³ ⁶²	Ahn JY...Lee JH	18094555	2007
45	[Blood cytokine levels as a clinical laboratory test]. ⁵³ ⁶²	Takahashi T...Maruoka H	17441472	2007
46	Characteristic changes in platelet-large cell ratio, lactate dehydrogenase and C-reactive protein in thrombocytosis-related diseases. ⁵³ ⁶²	Kabutomori O...Iwatani Y	17622783	2007
47	JAK-2 mutations and their relevance to myeloproliferative disease. ⁵³ ⁶²	Levine RL...Gilliland DG	17133099	2007
48	Molecular mimicry in the chronic myeloproliferative disorders: reciprocity between quantitative JAK2 V617F and Mpl expression. ⁵³ ⁶²	Moliterno AR...Spivak JL	16912229	2006
49	Diagnostic usefulness of the Janus kinase 2 mutation in non BCR/ABL myeloproliferative disorders. ⁵³ ⁶²	Bang SM...Lee JH	17249502	2006
50	Thrombopoietin and interleukin-6 levels in Henoch-Schönlein purpura. ⁵³ ⁶²	Lin CY...Chiang BL	17164950	2006

Sources

Genes for Thrombocytosis

Genes related to Thrombocytosis (0 elite genes):

(show all 32)

- Elite gene

- Cancer Census gene in COSMIC

#	Symbol	Description	Category	Score	Evidence	PubMed IDs
1	JAK2	Janus Kinase 2	Protein Coding	37.49	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Disorders Publications (show sections)	19999391 16325696 19222478 (more) 16781482 20151976 16673274 19903679 16871284 18616871 17920755 18484677 15781101 18094555 18220909 17249502 20194236 19657484 16977569 16285006 17032592 18032973 17688946 20154217 20008195 18575049 17171694 16879015 16197451 18160670 19773543 16912229 16155011 16953212 17285276 19174256
2	THPO	Thrombopoietin	Protein Coding	28.89	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	10190944 9626028 15300887 (more) 9375739 12447626 12171772 14767209 9432045 11843834 9858147 14689068 10477724 18041648 11675343 7643620 10784398 18414650 11472357 20008195 11849220 10454346 9766812 15390356 17164950 9163612 19461187 14725900 11860444 10841078 9714524 9657430 9488631 8547088 15647951 8982033 10828006 8946927 9633557 9753068 10583330 12468916 11680267 10554808 9609516 8940737 7539977 16115126 15929762 19581670 16210040 15282677 12841634 12243556 11454315 11122159 10595631 9614574 9260581 7959588 18367486 16995886 12730106 12634936 12430942 12384150 12226704 18314161 15847944 11474308 10037033 10945402 10552312 9824887 9354672 8652398 19436840 16266824 14608207 12902931 12630008 10786650 16679454 14608206 11071622 10027717 10583217 11320049 9574554 8703803 19553636 9858790 9690802 9207395 11378575 10930985 9425899 9551904
3	MPL	MPL Proto-Oncogene, Thrombopoietin Receptor	Protein Coding	27.83	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	19036112 10520034 15269348 (more) 17920755 15390356 9488631 18796624 10621836 18845793 16484586 14608207 20008195 19608689 12430925 19643476 19466980 18367486 16834459 17133099 16995886 12841634 11122159 9057636 12730106 9029014 18484677 17032464 14764528 19252138 12010817
4	EPO	Erythropoietin	Protein Coding	24.47	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	15298638 12243556 12515724 (more) 10784398 11378575 16898960 7589347 9102827 9654156 12756017 14608206 15025431 18760517 20197548 9253112 11317959 11918532 12902931 1380411 8338993 19303685 10595631 18397204 15270182 7869763 1544390 16231451 14608207 16673278 1552221 10811453
5	IL6	Interleukin 6	Protein Coding	24.13	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	7942941 1958487 11675343 (more) 10454346 16143693 1490150 11680267 2265245 7628586 8783415 7496073 19461187 7539977 10360671 12195834 11432624 8485049 9528833 7842401 1568463 1410278 8743659 9620893 15309018 8513864 7750122 7739278 8044791 19346724 11843834 10225680 9247285 8982048 8785456 9766812 9260581 9026853 7959588 1395742 1635173 1627787 11397324 10477724 9858147 9822051 9657430 9000479 7493683 8178944 1382717 1373705 2042096 1394040 11403226 10841078 17441472 17083384 15847944 12483964 11849220 11474308 11292190 11053081 8586748 7930877 8432472 17164950 12468916 11815715 9347652 8638438 7628876 8383628 1577093 2069514 18041648 16115126 12214155 11320049 8400277 8402641 9474133 11087252 12633573 16820206 2019273
6	TET2	Tet Methylcytosine Dioxygenase 2	Protein Coding	23	DISEASES inferred ¹⁴ GeneCards inferred via : Disorders Publications (show sections)
7	IL11	Interleukin 11	Protein Coding	22.53	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	11843834 15543003 7689197 (more) 12478901 7959588 10521086
8	CRP	C-Reactive Protein	Protein Coding	22.12	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	17083384 15513679 9632062 (more) 17622783 10921288 9141266 9247285 12621815 19581670 1857044 19647502 15206651 12195834 1767347 18334499 8018375 1635173 19009338 10783659 8624631 16143693 7842401 18041648 20070034 14648435 10910610 8785456 9599897
9	IL3	Interleukin 3	Protein Coding	22.06	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	7686030 1568463 11071622 (more) 7539977 1281895 8217838 10521086
10	SERPINC1	Serpin Family C Member 1	Protein Coding	21.5	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	14658533 8703831 12365581 (more) 9069476 9675960 9141800 11924107 8416679 2079995 7513998
11	CSF3	Colony Stimulating Factor 3	Protein Coding	21.08	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	7539977 9142195 15309018 (more) 7536478 17917868 19581670 7689197
12	F2	Coagulation Factor II, Thrombin	Protein Coding	20.82	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	8055222 16808787 16808761 (more) 17133980 19473438 19476716 16244771 18086120 11821991
13	PPBP	Pro-Platelet Basic Protein	Protein Coding	20.71	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	1826402 12781799 1836999 (more) 17127481
14	F3	Coagulation Factor III, Tissue Factor	Protein Coding	20.58	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	12816821 19009338 16244771
15	SELP	Selectin P	Protein Coding	19.51	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	9632062 10588461 12468916 (more) 15095037 12172143 10611541
16	CSF2	Colony Stimulating Factor 2	Protein Coding	18.53	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	1410278 7539977 10477724 (more) 1382717
17	IL1B	Interleukin 1 Beta	Protein Coding	18.2	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	2265245 8783415 14966463 (more) 12195834 1608682 7539977 7493683 9822051 9766812 8638438 16115126 9620893
18	LIF	LIF Interleukin 6 Family Cytokine	Protein Coding	17.22	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	1493463 15543003 19112126 (more) 9263535 9007222
19	KITLG	KIT Ligand	Protein Coding	17.08	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	7687220 7959588
20	THCYTX	Thrombocytosis, Familial X-Linked	Genetic Locus	16.4	GeneCards inferred via : Publications Gene name (show sections)
21	CALR	Calreticulin	Protein Coding	16.12	DISEASES inferred ¹⁴ GeneCards inferred via : Publications (show sections)
22	IL1A	Interleukin 1 Alpha	Protein Coding	15.58	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	8783415
23	CD177	CD177 Molecule	Protein Coding	15.52	DISEASES inferred ¹⁴ Novoseek inferred ⁵³	19999391 17032591 12515724 (more) 12730106 16502591 15461629 14617016 16197445 12756017
24	ASXL1	ASXL Transcriptional Regulator 1	Protein Coding	14.92	DISEASES inferred ¹⁴ GeneCards inferred via : Publications (show sections)
25	PF4	Platelet Factor 4	Protein Coding	14.88	DISEASES inferred ¹⁴ Novoseek inferred ⁵³	2140694 1826402 10086090 (more) 16462666 12781799 17127481
26	ALB	Albumin	Protein Coding	13.94	DISEASES inferred ¹⁴ GeneCards inferred via : Publications (show sections)
27	FGA	Fibrinogen Alpha Chain	Protein Coding	13.75	DISEASES inferred ¹⁴ Novoseek inferred ⁵³ GeneCards inferred via : Publications (show sections)	11549775
28	VWF	Von Willebrand Factor	Protein Coding	13.64	DISEASES inferred ¹⁴ Novoseek inferred ⁵³	9432029 11686107 9433378 (more) 16977568 8703834 17096909 9387201 15757851 1773983 8400231 10066153
29	STAT5B	Signal Transducer And Activator Of Transcription 5B	Protein Coding	13.5	DISEASES inferred ¹⁴ GeneCards inferred via : Publications (show sections)
30	U2AF1	U2 Small Nuclear RNA Auxiliary Factor 1	Protein Coding	13.28	DISEASES inferred ¹⁴ ¹⁴
31	STAT3	Signal Transducer And Activator Of Transcription 3	Protein Coding	13.09	DISEASES inferred ¹⁴ GeneCards inferred via : Publications (show sections)
32	SF3B1	Splicing Factor 3b Subunit 1	Protein Coding	12.83	DISEASES inferred ¹⁴ GeneCards inferred via : Publications (show sections)

Sources

Variations for Thrombocytosis

ClinVar genetic disease variations for Thrombocytosis:

⁵

#	Gene	Name	Type	Significance	ClinVarId	dbSNP ID	Position
1	PCDHA10, PCDHA1, PCDHA2, PCDHA3, PCDHA4, PCDHA5, PCDHA6, PCDHA7, PCDHA8, PCDHA9, [email protected]	NM_018900.4(PCDHA1):c.2394+67303_2394+69956del	DEL	Uncertain Significance	975862		GRCh37: 5:140235570-140238223 GRCh38: 5:140855985-140858638

Sources

Expression for Thrombocytosis

Search GEO for disease gene expression data for Thrombocytosis.

Sources

Pathways for Thrombocytosis

Pathways related to Thrombocytosis according to GeneCards Suite gene sharing:

(show all 41)

#	Super pathways	Score	Top Affiliating Genes
1	Innate Immune System ⁶⁶ Show member pathways Immune System ⁶⁶ Neutrophil degranulation ⁶⁶	13.93	CRP CSF2 CSF3 F2 IL11 IL1B
2	Signal Transduction ⁶⁶	13.74	PPBP KITLG JAK2 IL6 IL3 F3
3	ERK Signaling ⁶⁴ Show member pathways ILK Signaling ⁶⁴ MAPK Signaling ⁶⁴ Molecular Mechanisms of Cancer ⁶⁴ Rho Family GTPases ⁶⁴	13.72	THPO PPBP LIF KITLG JAK2 IL6
4	MIF Mediated Glucocorticoid Regulation ⁶⁴ Show member pathways all-trans-Retinoic Acid Signaling in Brain ⁶⁴ Endothelin-1 Signaling Pathway ⁶⁴ Glucocorticoid Receptor Signaling ⁶⁴ IL-6 Pathway ⁶⁴ MIF Regulation of Innate Immune Cells ⁶⁴ NFAT Signaling and Lymphocyte Interactions ⁶⁴ Overview of proinflammatory and profibrotic mediators ⁷⁴ PEDF Induced Signaling ⁶⁴ PGC1Alpha Pathway ⁶⁴ RAR-Gamma-RXR-Alpha Degradation ⁶⁴ STAT3 Pathway ⁶⁴	13.54	CSF2 CSF3 EPO F2 IL11 IL1B
5	TGF-Beta Pathway ⁶⁴ Show member pathways JAK-STAT Pathway ⁶⁴ JNK Pathway ⁶⁴ MAPK Family Pathway ⁶⁴ Regulation of eIF4 and p70S6K ⁶⁴ SOCS Pathway ⁶⁴	13.46	THPO PPBP MPL KITLG JAK2 IL6
6	Akt Signaling ⁶⁴ Show member pathways p38 Signaling ⁶⁴ Tec Kinases Signaling ⁶⁴	13.32	CSF2 CSF3 IL11 IL1B IL3 IL6
7	Cytokine Signaling in Immune system ⁶⁶ Show member pathways Signaling by Interleukins ⁶⁶	13.27	LIF JAK2 IL6 IL3 IL1B IL11
8	Response to elevated platelet cytosolic Ca2+ ⁶⁶ Show member pathways Disinhibition of SNARE formation ⁶⁶ Hemostasis ⁶⁶ Platelet activation, signaling and aggregation ⁶⁶ Platelet degranulation ⁶⁶	13.24	THPO SERPINC1 SELP PPBP MPL JAK2
9	PAK Pathway ⁶⁴ Show member pathways Antioxidant Action of Vitamin-C ⁶⁴ Epithelial Adherens Junctions ⁶⁴	13.06	CSF2 CSF3 IL11 IL1B IL3 IL6
10	p70S6K Signaling ⁶⁴ Show member pathways mTOR Pathway ⁶⁴ Renin-Angiotensin Pathway ⁶⁴	12.99	THPO PPBP KITLG JAK2 IL6 IL3
11	PI3K-Akt signaling pathway ⁷⁴ Show member pathways Focal adhesion: PI3K-Akt-mTOR-signaling pathway ⁷⁴	12.91	KITLG JAK2 IL6 IL3 EPO CSF3
12	NF-KappaB Family Pathway ⁶⁴ Show member pathways NF-KappaB (p50-p65) Pathway ⁶⁴	12.66	IL1B IL3 IL6 KITLG PPBP THPO
13	Malignant pleural mesothelioma ⁷⁴	12.65	KITLG IL6 IL1B CSF3 CSF2
14	Overview of interferons-mediated signaling pathway ⁷⁴ Show member pathways all-trans-Retinoic Acid Mediated Apoptosis ⁶⁴ Cytokine Network ⁶⁴ Immune response IFN alpha/beta signaling pathway ²² Interferon alpha/beta signaling ⁶⁶ Jak/STAT Signaling Pathway ⁶⁵ Regulation of IFNA/IFNB signaling ⁶⁶ Type III interferon signaling ⁷⁴	12.56	THPO PPBP KITLG JAK2 IL6 IL3
15	NF-kappaB Signaling ³	12.53	MPL KITLG JAK2 IL3 IL1B
16	Bacterial infections in CF airways ²² Show member pathways Altered glycosylation of MUC1 in tumor microenvironment ⁷⁴ IL-1 beta-dependent CFTR expression ²² IL1-mediated signaling events ⁶¹ Immune response Bacterial infections in normal airways ²² Immune response TLR signaling pathways ²² NTHi-Induced Signaling ⁶⁴ Signal transduction through IL1R ⁷⁴	12.38	JAK2 IL6 IL1B IL11
17	G-protein signaling RAC1 in cellular process ²² Show member pathways CDC42 signaling events ⁶¹ Cytoskeleton remodeling CDC42 in cellular processes ²² RAC1 signaling pathway ⁶¹	12.34	THPO PPBP KITLG IL6 IL3
18	IL-17 Family Signaling Pathways ⁶⁵ Show member pathways IL17 signaling pathway ⁶⁷ IL-17 signaling pathway ⁷⁴ Mucin expression in CF via IL-6, IL-17 signaling pathways ²²	12.23	JAK2 IL6 CSF3 CSF2
19	Embryonic and Induced Pluripotent Stem Cells and Lineage-specific Markers ⁶⁵	12.01	THPO LIF KITLG IL6 IL3 IL11
20	Interleukin-4 and Interleukin-13 signaling ⁶⁶	11.93	IL1B IL6 JAK2 LIF
21	Visual Cycle in Retinal Rods ⁶⁴	11.88	THPO MPL JAK2 CRP
22	Cytokine production by Th17 cells in CF (Mouse model) ²² Show member pathways Cytokine production by Th17 cells in CF ²²	11.85	JAK2 IL6 CSF3 CSF2
23	Th17 Differentiation ⁶⁵ Show member pathways IL-21 Signaling and its Primary Biological Effects in Different Immune Cell Types ⁶⁵	11.82	JAK2 IL6 IL1B
24	Clock-controlled autophagy in bone metabolism ⁷⁴	11.75	JAK2 IL6 IL3
25	Activation of NF-KappaB by PKR ⁶⁴ Show member pathways Canonical NF-kB pathway ⁷⁴ Cellular Transformation by HTLV1 ⁶⁴ Inhibition of PKR ⁶⁶ STING pathway in Kawasaki-like disease and COVID-19 ⁷⁴	11.75	JAK2 IL1B F3
26	Dendritic Cells Developmental Lineage Pathway ⁶⁵	11.71	IL6 IL1B CSF2
27	G-protein signaling_RhoA regulation pathway ²²	11.7	THPO PPBP KITLG IL6 IL3
28	Interleukin-6 family signaling ⁶⁶ Show member pathways IL-6-type cytokine receptor ligand interactions ⁶⁶ Immune response Oncostatin M signaling via JAK-Stat in human cells ²² Interleukin-6 signaling ⁶⁶	11.69	LIF JAK2 IL6 IL11
29	IL3-mediated signaling events ⁶¹ Show member pathways GMCSF-mediated signaling events ⁶¹ IL5-mediated signaling events ⁶¹	11.68	CSF2 IL3 JAK2
30	Th17 cell differentiation pathway ⁷⁴	11.67	JAK2 IL6 IL1B
31	Photodynamic therapy-induced NF-kB survival signaling ⁷⁴ Show member pathways Immune response MIF-mediated glucocorticoid regulation ²²	11.63	IL6 IL1B CSF2
32	IL 10 signaling pathway ⁶⁷	11.62	JAK2 IL6 IL1B
33	Lung fibrosis ⁷⁴	11.62	IL6 IL1B CSF3 CSF2
34	IL6-mediated signaling events ⁶¹	11.46	JAK2 IL6 CRP
35	Pluripotent stem cell differentiation pathway ⁷⁴	11.45	KITLG IL6 IL3 IL11 EPO
36	Interleukin-10 signaling ⁶⁶	11.39	LIF IL6 IL1B CSF3 CSF2
37	Hematopoietic Stem Cells and Lineage-specific Markers ⁶⁵	11.34	THPO MPL KITLG IL6 IL3 IL11
38	ncRNAs involved in STAT3 signaling in hepatocellular carcinoma ⁷⁴	10.98	JAK2 IL6 IL11
39	Cytokines and inflammatory response ⁷⁴	10.9	IL6 IL3 IL1B IL11 CSF3 CSF2
40	IL-9 Signaling and its Primary Biological Effects in Different Immune Cell Types ⁶⁵	10.76	IL6 IL1B
41	G-protein signaling_Rap2B regulation pathway ²²	10.76	THPO PPBP LIF KITLG IL6 IL3

Sources

GO Terms for Thrombocytosis

Cellular components related to Thrombocytosis according to GeneCards Suite gene sharing:

#	Name	GO ID	Score	Top Affiliating Genes
1	extracellular region	GO:0005576	10.12	CRP CSF2 CSF3 EPO F2 F3
2	extracellular space	GO:0005615	9.83	CRP CSF2 CSF3 EPO F2 F3
3	granulocyte macrophage colony-stimulating factor receptor complex	GO:0030526	9.46	JAK2 CSF2

Biological processes related to Thrombocytosis according to GeneCards Suite gene sharing:

(show all 21)

#	Name	GO ID	Score	Top Affiliating Genes
1	immune response	GO:0006955	10.21	PPBP LIF JAK2 IL6 IL3 IL1B
2	positive regulation of DNA-binding transcription factor activity	GO:0051091	10.18	JAK2 IL6 IL1B CSF3
3	positive regulation of MAPK cascade	GO:0043410	10.18	IL11 IL6 JAK2 LIF THPO
4	cell population proliferation	GO:0008283	10.14	THPO LIF KITLG IL11 CSF2
5	positive regulation of peptidyl-serine phosphorylation	GO:0033138	10.13	CSF3 IL11 IL6 LIF
6	positive regulation of phosphatidylinositol 3-kinase signaling	GO:0014068	10.1	SELP JAK2 F2 CSF3
7	cytokine-mediated signaling pathway	GO:0019221	10.1	CSF3 F3 IL1B IL6 JAK2 MPL
8	cellular response to lipopolysaccharide	GO:0071222	10.1	THPO PPBP JAK2 IL6 IL1B CSF3
9	response to lipopolysaccharide	GO:0032496	10.09	THPO SELP JAK2 IL1B EPO
10	embryo implantation	GO:0007566	10.07	LIF IL1B EPO
11	positive regulation of T cell proliferation	GO:0042102	10.06	KITLG JAK2 IL6 IL1B
12	positive regulation of receptor signaling pathway via JAK-STAT	GO:0046427	10.04	F2 IL6 JAK2
13	acute-phase response	GO:0006953	10.01	CRP EPO F2 IL6
14	positive regulation of tyrosine phosphorylation of STAT protein	GO:0042531	9.93	CSF2 EPO IL3 IL6 JAK2 LIF
15	myeloid cell differentiation	GO:0030099	9.91	TET2 JAK2 CSF2
16	positive regulation of leukocyte proliferation	GO:0070665	9.9	JAK2 CSF2
17	thrombopoietin-mediated signaling pathway	GO:0038163	9.88	THPO MPL
18	granulocyte-macrophage colony-stimulating factor signaling pathway	GO:0038157	9.86	JAK2 CSF2
19	positive regulation of peptidyl-tyrosine phosphorylation	GO:0050731	9.8	LIF KITLG JAK2 IL6 IL3 IL11
20	hemostasis	GO:0007599	9.72	SERPINC1 F3 F2
21	positive regulation of cell population proliferation	GO:0008284	9.72	CSF2 CSF3 EPO F2 IL11 IL1B

Molecular functions related to Thrombocytosis according to GeneCards Suite gene sharing:

#	Name	GO ID	Score	Top Affiliating Genes
1	growth factor activity	GO:0008083	9.96	CSF2 CSF3 F2 IL11 IL3 IL6
2	signaling receptor binding	GO:0005102	9.85	THPO LIF JAK2 IL6 F2 CSF3
3	cytokine activity	GO:0005125	9.64	THPO PPBP LIF KITLG IL6 IL3